- Fractint - mailman.xmission.com

[Feactint] Exploding Colors
by Albrecht Niekamp 03 Nov '15

03 Nov '15

There is a new one today, a zoom into yesterday´s image, nr.20. Maybe you like That one. Rotate the colors! https://www.cubbyusercontent.com/pl/MultifracArchive/_bb8cd4b47ce347b8a0669… Albrecht

2 1

Amusement Park
by Albrecht Niekamp 27 Oct '15

27 Oct '15

HI, after a long time of abstinence this is a new image - completely new and interesting enough for presentation. The combination of frms has never been used before and needed some time to generate. This is the link for the archive - ; https://www.cubbyusercontent.com/pl/MultifracArchive/_bb8cd4b47ce347b8a0669… ; select new-gif-newgif -nr.19 ; Albrecht ; ---------------------start par--------------------------------------------- 10863-09 { ; Amusement Park ; Time 0.11.31.46 Reso 1280/1024 ; Secant-Lambda-Phoenix-Bees reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/cabs/ident passes=t center-mag=2.78599/0.768859/10.22138/1/2.50000000000003331/8.94423424213\ 641738e-014 params=-1.069911801507614/-0.3965514084292124/10863.32005750112/20341.05\ 06020602/152048.0404808025/0.160489402241/0.00482000595/0.1007683/512.10\ 00083000999/512.1000083000999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000MA1<3>C92<6>TXAV`BXcC<3>grI<3>TnXQm_MlcIkgEfp9az<3>OJoRFlVAiZ5\ fb0cd7_iFRnNIyb0yj0000yr0yz1yzC<2>yzz<3>iqdeo_alU<3>Lb8<3>KQ8JM8JJ8<2>H8\ 8G44F00<3>SA5VD6YF7`I8dLAgMBhODiQF<3>peBqiAsm9uq8wu7yz5yz4yz3<4>yj4yg4yc\ 4<3>yS5yP5yL6yI6yE6vE6sD6<6>uAIu9Ku9M<3>w7Sx7Ux6Wy6Yy5_<3>e5M`5IV4E<2>Z4\ H<3>O3DM2CJ2A<3>705F0BN0G<3>f0Uk0Xp0`u0d<2>x0fy0gx0h<3>t1ms1nr1oq2q<2>u2\ u<3>b5eY6`T6X<2>E9L9AG6FO3KW0Qc0Sc<3>5Zc6`c6aa6c_6eY<3>EcgGciIbl<3>R_v<3\ >bivelvhnvkqvntvrww<2>yzz<3>pwznvzgrw<3>Fch7_d7Xa<3>7JO7FL7CI<4>WCA`B9eB\ 7<3>yA0<14>PA1 } ---------------------end---------------------------------------------------

1 0

Fwd: Reading Fractal Map
by sciwise＠ihug.co.nz 26 Oct '15

26 Oct '15

-------- Original Message -------- SUBJECT: Reading Fractal Map DATE: Mon, 26 Oct 2015 23:06:33 +1300 FROM: sciwise(a)ihug.co.nz TO: A BASIC program is available at FreeBASIC , Forums , Projects [Fractal Map] that reads the values for the Volterra-Lotka fractal generated by fractint. The technique might also be applied to other fractals. I've sorted through the wealth of past posts and there is the possibility that a similar ability of plotting the fractal series exist from fractint. Edward

1 0

35187-4
by Albrechtx 26 Oct '15

26 Oct '15

HI, got some time waiting for my flight, so using it to present one more image which is to beautiful to be kept a secret. ; https://www.dropbox.com/s/838eadbt0iq3qdl/35187-4.GIF Albrecht

3 3

FW: Reading Fractal Map - Volterra-Lotka
by Hal Lane 26 Oct '15

26 Oct '15

> ...the possibility that a similar ability of plotting the > [Volterra-Lotka] fractal series exist from fractint. My FRADOC 20.4 says: (I hope this copy & paste doesn't "wrap" and wind up being hard to read...) ---------------------------------------------------------------------------- Fractint Version 20.04 Page 83 2.51 Volterra-Lotka Fractals (type=volterra-lotka) In The Beauty of Fractals, these images are offered as an example of "how an apparently innocent system of differential equations gives rise to unimaginably rich and complex behavior after discretization." The Volterra-Lotka equations are a refinement of attempts to model predator- prey systems. If x represents the prey population and y represents the predator population, their relationship can be expressed as: dx/dt = Ax - Bxy = f(x,y) dy/dt = -Cy + Dxy = g(x,y) According to Peitgen and Richter, "Hence, x grows at a constant rate in the absence of y, and y decays at a constant rate in the absence of x. The prey is consumed in proportion to y, and the predators expand in proportion to x." They proceed to "discretize" this system, by "mating" the Euler and Heun methods. For purposes of image computation, their formula (Equation 8.3 on page 125) can be interpreted as: x(new) = x + h/2 * [ f(x,y) + f[x + pf(x,y), y + pg(x,y)] ] y(new) = y + h/2 * [ g(x,y) + g[x + pf(x,y), y + pg(x,y)] ] [Note: I believe that "pf()" and "pg()" are "p*f()" and "p*g()" -Hal] This formula can be used to plot or connect single points, starting with arbitrary values of x(0) and y(0), to produce typical "strange attractor" images such as the ones commonly derived from the Henon or Lorenz formulae. But to produce an escape-time fractal, we iterate this formula for all (x, y) pairs that we can associate with pixels on our monitor screen. The standard window is: 0.0 < x < 6.0; 0.0 < y < 4.5. Since the "unimaginably rich and complex behavior" occurs with the points that do NOT escape, the inside coloring method assumes considerable importance. The parameters h and p can be selected between 0.0 and 1.0, and this determines the types of attractors that will result. Infinity and (1, 1) are predictable attractors. For certain combinations, an "invariant circle" (which is not strictly circular) and/or an orbit of period 9 also are attractive. The invariant circle and periodic orbit change with each (h, p) pair, and they must be determined empirically. That process would be thoroughly impractical to implement through any kind of fixed formula. This is especially true because even when these attractors are chosen, the threshold for determining when a point is "close enough" is quite arbitrary, and yet it affects the image considerably. The best compromise in the context of a generalized formula is to use either the "zmag" or "bof60" inside coloring options. See Inside=bof60|bof61|zmag|fmod|period|atan (p. 183) for details. This formula performs best with a relatively high bailout value; the default is set at 256, rather than the standard default of 4. Fractint Version 20.04 Page 84 Reference: Peitgen, H.-O. and Richter, P.H. The Beauty of Fractals, Springer-Verlag, 1986; Section 8, pp. 125-7. ------------------------------------------------ It strikes me that since there are only two parameters, h and p, that one might be able to use Fractint's Explorer/Evolver to vary them both and see the variety of "unimaginably rich and complex behavior" in a single screenfull of 'thumbnails.' See: FRADOC 20.4: pg 98: "3.12 Parameter Explorer/Evolver" or: http://www.nahee.com/spanky/www/fractint/findex.html I use <ctrl>-F in my browser to find my topic on this long table of contents page. I would try this, except I'm about to "Factory Restore" my Win8.1 machine. --------------------------------------------------- . . . " ...x represents the prey population . . . and y represents the predator population..." I once saw this relationship between predator and prey drawn in accelerated real time on the face of an oscilloscope by an analog computer. It drew this *Phase Space Plot* that shows the Number of Predators versus the Number of Prey (scroll down to the 2nd plot): http://tinyurl.com/Lotka-Volterra-equations or: https://en.wikipedia.org/wiki/Lotka%E2%80%93Volterra_equations#A_simple_exam ple - Hal Lane ######################## # hallane(a)earthlink.net ######################## -----------Original Message------------- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of sciwise(a)ihug.co.nz Sent: Monday, October 26, 2015 6:07 AM To: fractint(a)mailman.xmission.com Subject: [Fractint] Reading Fractal Map A BASIC program is available at FreeBASIC , Forums , Projects [Fractal Map] that reads the values for the Volterra-Lotka fractal generated by fractint. The technique might also be applied to other fractals. I've sorted through the wealth of past posts and there is the possibility that a similar ability of plotting the fractal series exist from fractint. _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

1 0

Reading Fractal Map
by sciwise＠ihug.co.nz 26 Oct '15

26 Oct '15

A BASIC program is available at FreeBASIC , Forums , Projects [Fractal Map] that reads the values for the Volterra-Lotka fractal generated by fractint. The technique might also be applied to other fractals. I've sorted through the wealth of past posts and there is the possibility that a similar ability of plotting the fractal series exist from fractint.

1 0

John W Cast it
by JackOfTradeZ＠comcast.net 23 Oct '15

23 Oct '15

. I'm not exactly sure of what you are doing, but you can use any of my viddies for your project(s) just give proper credit where due. A zip file should unzip and release the WMV video - I don't understand your issue. BTW - I HATE MicroShaft! The only good thing ever come out of Redmund was VB, and it looks like it's days are over {doing Python now anyway}. .

4 3

Kaleidescope
by JackOfTradeZ＠comcast.net 22 Oct '15

22 Oct '15

. ok - got it. google chrome ran it ok. AWESOME! wish I could save it as a video file, flash sucks. look closely - it isn't a fractal [ie, mathematically rendered in the usual sense] I think this Romanian dude just gave his computer a good hit of acid. .

2 1

Corrections and explanations
by John Wilson 21 Oct '15

21 Oct '15

http://inoyan.narod.ru/kaleidoskop.swf My apologies for screwing up my message regarding Kaleidoscop. Bad eyesight caused me to omit a period and misread an "f" for an "l". I'm intrigued by the thing, which looks to me like a Fractal viewed in a kaleidoscope with three, or possibly six, mirrors. It's initially fascinating, even hypnotic, but soon loses its novelty. Even though the "kaleidoscope" can be moved with the mouse to view different portions of the basic underlying fractal. Familiarity breeds contempt and this is not quite shaking the bits of colored shapes in a real kaleidoscope, to re-arrange them into a new pattern. After a little thought I think I have the answer, and his name is JackOfTradeZ. Now I'm using a Chromebook to Chromecast movies to my 42-inch T.V. and Kaleidoscop is quite spectacular when viewed in this fashion. I then speculated that a Fractint zoom by Lloyd Garrick could well form the right "shaker" for Kaleidoscop. I first had to check that I could cast of these zooms, and the last one I had downloaded was "The_Prophet." My Chromebook refused to cast it, as it was encoded as a Zipped .wmv file. (Because JackOfTradeZ just LOVES Microsoft). My Chromebook just spat and suggested that I had the file converted to a .webm format, and recommended http://Online-Convert.com . Online-Convert is a miraculous outfit, which seems to convert just about anything to anything else. It swallowed that Zipped .wmv file whole, digested it and returned me "The_Prophet.webm". This casts nicely. That was the hard part! Now all I must do is to ask permission to use one of those zooms and ask the author of Kaleidoscop jf he would be interested in such a project. My ex-wife #2 was born in the old USSR, and if I can enlist her help in contacting the author I'll be in business. As far as I'm concerned this part is not a do-it-yourself project. The final objective is for me to be able to sit at my coffee table in front of the T.V. watching marvels. Boccherini on the stereo system and a subtle incense in the air, plus a cheese board in front of me along with a glass of Madeira. Well, I can dream can't I? John W.

1 0

Re: [Fractint] Fractint Digest, Vol 152, Issue 10
by Roger Kaufman 21 Oct '15

21 Oct '15

Hi J, Did you try to open it in a browser. I had to have Flash installed. Under Linux this is a little more complicated, but Adobe does have a standalone Flash player. It is a really cool Kaleidoscope you can control with your mouse. What I was trying to see is if the underlying image is a fractal image. I believe it is. Fractal images might make nice Kaleidoscopes in general. Roger On 10/21/2015 2:00 PM, fractint-request(a)mailman.xmission.com wrote: > http://inoyan.narod.ru/kaleidoskop.swf > > > > . > Opens in VLC player [Fedora 21] ; but it just flashes a brief image and exits.

1 0

??
by JackOfTradeZ＠comcast.net 21 Oct '15

21 Oct '15

. http://inoyan.narod.ru/kaleidoskop.swf . Opens in VLC player [Fedora 21] ; but it just flashes a brief image and exits. .

2 1

Fractal?
by John Wilson 21 Oct '15

21 Oct '15

http://inoyan.narodru/kaleidoskop.swl Mouse over this. Think this is/was a fractal? How can I tell? John W.

2 2

Re: [Fractint] Fractal?
by David Jones 21 Oct '15

21 Oct '15

Typo in the link below. "narodru" should be "narod.ru"? David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.comOn Oct 20, 2015 19:48, James R McKenzie <jimmckenzie(a)earthlink.net> wrote: > > > I can't get it to load. FireFox 41.0.2 for Ubuntu says it can't find a server for the page. > Anyone else having similar trouble? > > > > -----Original Message----- > >From: John Wilson <1stdiscus(a)gmail.com> > >Sent: Oct 20, 2015 9:14 PM > >To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> > >Subject: [Fractint] Fractal? > > > >http://inoyan.narodru/kaleidoskop.swl > > > >Mouse over this. Think this is/was a fractal? How can I tell? > > > >John W. > >_______________________________________________ > >Fractint mailing list > >Fractint(a)mailman.xmission.com > >https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Re: [Fractint] Fractal?
by James R McKenzie 21 Oct '15

21 Oct '15

I can't get it to load. FireFox 41.0.2 for Ubuntu says it can't find a server for the page. Anyone else having similar trouble? -----Original Message----- >From: John Wilson <1stdiscus(a)gmail.com> >Sent: Oct 20, 2015 9:14 PM >To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> >Subject: [Fractint] Fractal? > >http://inoyan.narodru/kaleidoskop.swl > >Mouse over this. Think this is/was a fractal? How can I tell? > >John W. >_______________________________________________ >Fractint mailing list >Fractint(a)mailman.xmission.com >https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

SORRY It's a .swf not a .swl
by John Wilson 21 Oct '15

21 Oct '15

http://inoyan.narod.ru/kaleidoskop.swf

1 0

Fractal?
by John Wilson 20 Oct '15

20 Oct '15

Think this is/was a fractal? How can I tell?

1 0

BDay
by JackOfTradeZ＠comcast.net 19 Oct '15

19 Oct '15

. Well, thanx much folks. But HOW did anyone know !? Nothing is private or sacred in cyberspace I guess. .

1 0

WAV -> MIDI converter?
by Bill Jemison 19 Oct '15

19 Oct '15

Does anyone know of a good, preferably free, .wav to .mid converter for Windows?

7 13

WTF
by JackOfTradeZ＠comcast.net 14 Oct '15

14 Oct '15

. following this win-10 issue, I will just say that I have given up on microshaft, if possible, for good. I am still using XP on a couple of my systems - and quite satisfied. One of them runs fractint no problem, the other doesn't - so it must be hardware issue. I never bothered with any OS after XP, although I have win-7 at work. I am sick of this forced upgrades every 2 years, just when you start getting comfy with the OS, and the lack of backwards compatibility is deliberate treachery on Mr. Bill's part. Sooo - I have been migrating to Linux, about 80% complete now. It is much leaner than windoze; I just made a 32K frame animation at 1400 resolution - the file barely fits on a DVD. WinXP can not open and play it, but in Linux it cruises no problem! I installed DOSbox, but haven't had time to play much with it yet. I am pondering trying xfractint now, or maybe wait till it gets more refined. Whatever. As for sstools.ini - I have always had all my fractint files in one same directory - so no need to mess with file paths; seems to work better. And it shouldn't have lines that aren't being used, you can put a semicolon in front to comment them out. If you are rendering from a PAR file the PAR values will override the sstools.ini - some people don't know that and it leads to errors and confusion.. .

4 7

Q re input of an old video recorder and the EXT connection
by Hal Lane 14 Oct '15

14 Oct '15

Albrecht, > ...does anyone know more about this subject? > ...I use the input of an old video recorder and the EXT connection. 1) What are the signal formats of the old video recorder's: - input and - its EXT connection? 2) And, am I correct in my guesses that: - the EXT connection is the output of the video recorder? - and that the output of the video recorder is connected to your flat screen display? - Hal Lane (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Multifrac(a)t-online.de Sent: Tuesday, October 13, 2015 9:34 AM To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> Subject: Re: [Fractint] WTF On 13.10.2015 05:16, david wrote: > Ages ago, I wrote a fractal generator in 6510 Assembly language for > Commodore 64. It took almost a day to render a single 320*240 Mandelbrot. > >> The work many have done with fractals is astounding. Long time ago I wrote a fractal program for the atari xl computer, it´s still running! It was written in clean assembler and reasonably fast. It was even capable of doing my own kind of Julia and a basic 3d generation. To display it on my flatscreen I use the input of an an old video recorder and and the EXT connection. I think there is a special adapter for these old 8bit computers, does anyone know more about this subject? Albrecht _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

1 0

Re: [Fractint] WTF
by David Jones 11 Oct '15

11 Oct '15

Well, I understand that W98 and W3.1 are completely immune to all current malware. Install no Java or Flash. Use a very old version of Opera (from before it supported Javascript). Or switch to Linux. ;) David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.comOn Oct 10, 2015 19:25, Multifrac(a)t-online.de wrote: > > On 07.10.2015 20:42, JackOfTradeZ(a)comcast.net wrote: > > I never bothered with any OS after XP, although I have win-7 at work. I am sick of this forced upgrades every 2 years, just when you start getting comfy with the OS, and the lack of backwards compatibility is deliberate treachery on Mr. Bill's part. > Fully agree although the W7 support has been extended to 2020 - see > below copy of the official > Microsoft info: > > Windows 7 * > > > > Service Pack 1 > <http://windows.microsoft.com/de-de/windows7/learn-how-to-install-windows-7-…> > > > > > 13. Januar 2015 > > > > 14. Januar 2020 > > : > I´m still using XP on one machine thanks to the XP Dos mode. > There´s no security risk whatsoever as long as Bitdefender Free > do not end their support. Their triple defense - Mainprotection, > Traffic light and Quickscan as Firefox plugins works perfectly and I > experience very few attacks - compared to W7. > Albrecht > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Final sstools
by John Wilson 06 Oct '15

06 Oct '15

Along with some of my hair, teeth, hearing and sight I have lost considerable memory. Back in the 90's I played with Fractint without any problem, but I have not been able to remember "howto" just recently. Now I'm in business again, and without all the complex "sstools" statements recommended. This is the whole of my final file: [fractint] inside=0 map=maps\default.map ifsfile=ifs\fractint.ifs parmfile=pars\fractint.par lfile=lsystem\fractint.l formulafile=formulas\fractint.frm autokeyname=key\auto.key savename=gif_s I don't know why this works, but it's something to do with the way I'm setup in DOSBox. In the config file I set cycles="max", fullscreen="true" and added: [autoexec] mount c c:\fractl\ c:\ fractint.exe Without this autoexec the mounting commands must be typed in... with poor results. Fractint goes back into its snit-fit about pctools and, when allowed to continue, runs at its usual steady rate. Return to the DOSBox modifications and the program goes back into overdrive, and with no pctools problem. Something to do with all those "c's" ? Anyway I'm happy with my Fractint-dedicated DOSBox... don't have to understand it! During this investigation I discovered that Microsoft does not support *.hlp files in WIN 10. Navigation is ponderous, at least in my installation, and dragging files across the screen tortuous... sometimes taking 5 or 6 seconds for the mouse pointer to attach to the top of the file. Maybe it will improve. John W.

2 1

That *&^$%# sstools!
by John Wilson 29 Sep '15

29 Sep '15

I just can NOT get my sstools to behave as I want it to, in spite of your advice. I wonder if anyone could point out where I'm going astray? Failed trials are disabled by ";". Fractint runs like the proverbial bat out of —, but the files are saved into my "Fractl" directory. map=maps\default.map ;savename=gif001 ; savename=c:\fractl\fractint\gif\nick001 ; filename=c:\fractl\Fractint\GIF_s\ ; gifdir=c:\fractl\fractint\gif_s ; gifdir=c:\fractl\fractint\*.gif ifsfile=ifs\fractint.ifs parmfile=pars\fractint.par lfile=lsystem\fractint.l formulafile=formulas\fractint.frm ; SAVENAME=c:\Fractl\FractInt\GIF_s\fract001.gif ; OVERWRITE=no autokeyname=key\auto.key

3 4

The fine detail in the patterns...
by Hal Lane 27 Sep '15

27 Sep '15

The fine detail in the patterns on the chameleons in these nice hand-generated images made me initially think 'fractals!' -- but I'm not so sure now: http://tinyurl.com/Abstraction-finds-beauty or: http://proof.nationalgeographic.com/2015/09/15/abstraction-finds-beauty-in-b easts/ Any comments on that thought? <== <== - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

2 1

Good old SSTOOLS.
by John Wilson 24 Sep '15

24 Sep '15

I'm tired of having all my GIF's tumble into my FRACTINT folder along with all the other files. I have not, however, found the instructions used in SSTOOLS for auto saving rendered GIF's into a GIF folder. Help, please? Thank you, John W.

3 2

DOSBox on Windows 10
by David W Riccio 18 Sep '15

18 Sep '15

There is a download for DOSBox for Windows 10, I have not tested Fractint in that version yet. Has anyone in the group?

2 1

fractint in Windows 10
by Nick Grasso 18 Sep '15

18 Sep '15

Since Microsoft is pretty much forcing us to 'upgrade' to Windows 10, does anyone know if DOSBox works in Windows 10 in order to run fractint? Nick

3 4

DosBox in WIN 10
by John Wilson 17 Sep '15

17 Sep '15

I had the same experience as Tim, exactly... "First, the answer is that DOSBox and Fractint run fine under Windows 10. This is the same DOSBox I had been using under Windows 8.1 (DOSBox svn 0.74). I haven't yet installed the latest Win 10 DOSBox". It also installs in a Chromebook HOWEVER, there's a problem with that one. The Chromebook keyboard is missing a couple of keys used by Fractint. and the upper row of keys must be reset to Function keys. Head scratching helps. John W.

1 0

Formentera Beach
by Albrecht Niekamp 16 Sep '15

16 Sep '15

This item uses yesterday´s image again and the algorithm is similar but there is an important update: After some meditation - of course the fractal rhythm is extremely sophisticated - I found a possibility to improve the musical flow and add better melodical elements. The problem is that the midi capacity has reached it´s maximum. The fractal rhythm consists of 300 elements, 30 for each voice and even a time error of 1/16 triplet means complete failure, so I recommend to use only the mp3 download, it sounds better anyway. To the title: If you ever have spent a vacation on the most beautiful mediterranean island and listened to the the gentle waves rolling over the white sand you know wgat I had in mind. Yesterday´s link is still valid. ; https://www.cubbyusercontent.com/pl/MultifracArchive/_bb8cd4b47ce347b8a0669… ; Albrecht

2 4

[fRACTINT] Natuaral Music - Summer Rain
by Albrecht Niekamp 11 Sep '15

11 Sep '15

Summer Rain ; This is a new Natural Music item. The title needs no explanation, just relax and listen. The IFS used for scanning is "Square.ifs" which ensures every pixel of the source image, "Move3.bmp", is used for conversion ; https://www.cubbyusercontent.com/pl/Summer+Rain/_9771637c20c54ee782f0df69fd… ; Albrecht

4 9

Wild Brains
by Mike Frazier 11 Sep '15

11 Sep '15

This fractal mixes cos and z * sin. It has minibrots surrounded by arms made up of smaller triple arms. Each minibrot in the area is a bit different than the others. The structures surrounding the minibrot look a little like brains and the colors are wild so thats how I picked the name. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/wild_brains_800_5.jpg The FractInt compatible PAR file for the image is: Wild_Brains { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150911_0844 passes=1 float=y center-mag=0.178114722948035/0/9480790966.936275/1\ /0/0 params=1/1/0/0/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=000510B20G30N50T60Y70d80cA0_D0WG0XIIcTTi``p\ jjwuuyxxtmmoddjUUdJJ`BBW00x0Us0Sm0Pi0Nd0K`0IW0GQ0D\ M0BH08D06804201100703C06G08M0BQ0DW0G`0Jd0Lj0Nn0Pt0\ Sy0VXHHaPPeVVjaaoiisooxvvzyyvrrskkpffm__jVVgOOcHHa\ CCY55W00W33W77WAAWDD000D30Q50b80ZE0`NNnhhyxxm__bEE\ x0Um0Pa0JS0EH08603503G08R0Eb0Jn0Py0VbRRleexvvuppnb\ bhQQ`AAW22W99zzz`jjAUU8PP7KK5EE399144zzzgmhTbVOXQJ\ QKEJF9DA465wwsliUbYAWS8PM6IF5B93431xvsreRkT5bN4UI3\ MD2D81430snofSTZKLSGHLCDF99855211qor_VcSNWNJQIEKDA\ E868222llpUUbMMUHHODDI99C446000fssHiiEabBUV7MO4EG2\ 78zzzmrrUeeAUU9QQ7MM6II5EE3AA277133zzzqtqbjdTbVPYR\ LTNIOJEJFAEB698343zzztsmliUcZAZV9UQ8PM6KH5EC498243\ 1zzzwrlreRmU5fQ4`M4UI3OE2HA2B71430zzzsnoiYZaMNXJKS\ GHNDEIBBD88855322zzzqord`gVPZRMUNJQJGLFCHB9C868333\ zzzqqsbbiPPZMMUIIQFFLCCH99C558223zzzmuuUnnGggEabBW\ X9QR6KM4EG39A144000000000 } frm:F_20150911_0844 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2),d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/((cos(z)-1)+c1)+1/(z*sin(z)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

Fractint triumph.
by John Wilson 08 Sep '15

08 Sep '15

Been playing madly with my machines—got my Asus Chromebook to run DOS! How? Using a DosBox installation. Why? So I can run Fractint in there. The machine runs for 12 to 15 hours between charges—no hard drive to drain the battery. So I can play Fractals in the coffee shop or read a book! Offline. Fractint seems quite fast, and I have some adjustments yet to make. Now I'm ready for that slacker, Jim Muth, to fulfill his promises. ☺ John W.

2 1

reFW: Tangent Void
by Hal Lane 08 Sep '15

08 Sep '15

Mike thanks for the image -- tangent_void_800_5.jpg I like the blue background brightening to almost an electric blue -- which then nicely highlights the arms of the "foreground" pattern. The dark collections of "holes" in the background hint that there is something else hidden behind the blue background, too. - Hal Lane ######################## # hallane(a)earthlink.net ####################### -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Mike Frazier Sent: Monday, September 7, 2015 12:49 PM To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> Subject: [Fractint] Tangent Void This fractal mixes tangent and z^2. The area around the minibrot has some interesting shapes. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/tangent_void_800_5.jpg The FractInt compatible PAR file for the image is: Tangent_Void { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150907_1030 passes=1 float=y center-mag=4.140284923502022/0/14653.60246442613/1\ /0/0 params=1/-1/2/2/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=0000Tv0Rr0Pn0Nj1Mf1Kb1IZ1GV2FS2DO2BK29G38C3\ 6834442054376788BAAFBCIDFMEHQGJUHLXJN`KQdMShNUkPWo\ QYsS`wRZtPXpOVmMTiLReJPbINZGKVFISDGOCELACH9AD78A66\ 64324554894BC5DG5GK5JN6LR6OV6RY7Ta7Wd7Zh8`l8co8fs9\ iw9gt8dp8al7Zh7We6Ta6QY5NU4LR4IN3FJ3CF29C268134000\ 22344776B98FCAIECMHEQJGULIXOK`QMdTOhVQkYSo_UsbXwbY\ u`WqYUmWSiUQeROaPMYMJUKHQIFMFDIDBEA9A8766522202332\ 5727B28F2AI2CM2DQ1FU1HX1I`1Kd1Mh1Nk1Po1Rs000O40hI0\ ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua\ 0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0z\ y0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0\ ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua\ 0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0h\ I0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0\ O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O4\ 0000O40hI0ua0zy0ua0hI0O40 } frm:F_20150907_1030 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2)-1,d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(z^b)*tan(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

1 0

Tangent Void
by Mike Frazier 07 Sep '15

07 Sep '15

This fractal mixes tangent and z^2. The area around the minibrot has some interesting shapes. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/tangent_void_800_5.jpg The FractInt compatible PAR file for the image is: Tangent_Void { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150907_1030 passes=1 float=y center-mag=4.140284923502022/0/14653.60246442613/1\ /0/0 params=1/-1/2/2/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=0000Tv0Rr0Pn0Nj1Mf1Kb1IZ1GV2FS2DO2BK29G38C3\ 6834442054376788BAAFBCIDFMEHQGJUHLXJN`KQdMShNUkPWo\ QYsS`wRZtPXpOVmMTiLReJPbINZGKVFISDGOCELACH9AD78A66\ 64324554894BC5DG5GK5JN6LR6OV6RY7Ta7Wd7Zh8`l8co8fs9\ iw9gt8dp8al7Zh7We6Ta6QY5NU4LR4IN3FJ3CF29C268134000\ 22344776B98FCAIECMHEQJGULIXOK`QMdTOhVQkYSo_UsbXwbY\ u`WqYUmWSiUQeROaPMYMJUKHQIFMFDIDBEA9A8766522202332\ 5727B28F2AI2CM2DQ1FU1HX1I`1Kd1Mh1Nk1Po1Rs000O40hI0\ ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua\ 0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0z\ y0ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0\ ua0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua\ 0hI0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0h\ I0O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0\ O40000O40hI0ua0zy0ua0hI0O40000O40hI0ua0zy0ua0hI0O4\ 0000O40hI0ua0zy0ua0hI0O40 } frm:F_20150907_1030 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2)-1,d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(z^b)*tan(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

Life Form
by Albrecht Niekamp 03 Sep '15

03 Sep '15

Life Form ; https://www.cubbyusercontent.com/pli/18_35010-35.GIF/_4c8f164891b940f8a82ef… ; Albrecht ; ---------------------Start Par--------------------------------------------- 35010-35 { ; Life Form ; Time 0.02.58.57 Reso 1280/1024 ; MFR14 TwoPass Image reset=2004 type=formula formulafile=mfr14.frm formulaname=mfr_14_2 function=sin/flip/atan/sin passes=t center-mag=0.633075/0.00669753/0.6661081/1/-91.5997542866066965/-0.00029\ 6182258072465177 params=-0.05825983458967864/0.3785210730307932/35010.6459576706/45235.49\ 11030602/152048.0404808048/1.1604894048/2.00482000595/0.1000003001/422.2\ 000003001/768.1000003001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 sound=off colors=000G46<3>301pUn<49>636535424<3>000VO2<15>970860650<3>110zh3<35>A7\ 0860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM7\ 6BSQO<38>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57 } ----------------------------------------------------------------------------

2 1

Fractint version 20.04 patch 14 released
by Jonathan Osuch 23 Aug '15

23 Aug '15

Folks, Fractint version 20.04 patch 14 was released today. The executables can be found at: www.fractint.net or www.fractint.org Here is what's new: Re-fixed the formula type buffer overflow in Xfractint. Fixed savetime=y to work with Xfractint. Jonathan

2 2

Butterfly
by Albrecht Niekamp 22 Aug '15

22 Aug '15

This is my version of a butterfly. Check the parent view for many different variations. ; https://www.cubbyusercontent.com/pli/17_MUL231K3.GIF/_b8d55b08d1e6496b91243… ; ----------------------------------------Start par--------------------------------------------------------------------------------------- Butterfly { ; mul231k3 ; Time 0.07.48.90 Reso 1280/1024 ; Frm: Multifrac231 dtd 2003 ; Search parent view for more butterflies reset=2004 type=formula formulafile=mfr.frm formulaname=multifrac_231 ismand=n function=exp/exp passes=t center-mag=-0.307464/0.00373021/7.559265/1/90/3.88578058618804789e-016 params=-0.00180974761192663/-0.2758911404766991/1536/2048/513/1025/-2/3/\ 128/128 float=y maxiter=2048 inside=maxiter outside=tdis periodicity=0 rseed=-2436 sound=off colors=000usiwukzwm<6>cYO`UKYQG<3>KA0000<43>000<4>000330<11>110110110<3>\ 000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C\ <3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3\ >7UX6`Z4h_2oa0wc<11>2TG2RE3OC<3>4D3<20>rqg } ----------------------------------------End --------------------------------------------------------------------------------------------------

1 0

Re: [Fractint] ButterFly
by Hal Lane 14 Aug '15

14 Aug '15

> Is there a mathematical formula, something the fractint parser could use? "I found what appears to be the/a calculation here:" http://phelafel.technion.ac.il/~orcohen/butterfly.html That page says: "The code for this project was *written in MATLAB* and can be found here." http://phelafel.technion.ac.il/~orcohen/butterfly/code.zip I looked at the code and, clearly, it's not "fractint ready". The formulas they wrote appear to be organized as subroutines and function/subroutine calls to the MATLIB library. Fractint doesn't support function/subroutine calls. It's possible that the subroutines they wrote could be "unrolled" and code written to provide the MATLIB functions that they called... Try searching for *Fractint-compatible* hofstadter's butterfly code on non-Fractint fractal program web sites (UltraFractal, etc.) On this UltraFractal page: http://formulas.ultrafractal.com/cgi/formuladb?browse I did not find: hof or: but Anyone know what other fractal programs have Fractint-compatible code? <--<< - Hal Lane ######################## # hallane(a)earthlink.net ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of JackOfTradeZ(a)comcast.net Sent: Friday, August 14, 2015 12:55 AM To: fractint(a)mailman.xmission.com Subject: [Fractint] ButterFly . Is there a mathematical formula, something the fractint parser could use? Looks like it might make a good morph animation. . _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

1 0

ButterFly
by JackOfTradeZ＠comcast.net 14 Aug '15

14 Aug '15

. Is there a mathematical formula, something the fractint parser could use? Looks like it might make a good morph animation. .

1 0

Re: [Fractint] I just ran across this fractal object: Hofstadter's butterfly:
by Hal Lane 13 Aug '15

13 Aug '15

Tony, > Any Fractint code for rendering this? I don't have any. You might try searching for Fractint-compatible code an non-Fractint program web sites (UltraFractal, etc.) I just tried a couple of searches (use the quotes to keep the two words together during the search): calculate "hofstadter's butterfly" code to calculate "hofstadter's butterfly" Since: ... "In physics, Hofstadter's butterfly is a mathematical object ... describing the theorised behaviour of electrons in a magnetic field." ... (Wikipedia) I'm not likely to be able to derive the equations myself... http://tinyurl.com/Hofstadters-butterfly-spotted or: http://physicsworld.com/cws/article/news/2013/may/15/hofstadters-butterfly-… gives a general overview of the calculation: "Hofstadter encountered a difficulty when considering electrons exposed to a magnetic field while moving in a 2D lattice. The problem lies in the fact that electrons respond to an applied magnetic field by swimming in circles at the cyclotron frequency. However, the orbital motion of the electrons is quantized in terms of a frequency that is defined by the properties of the crystal lattice. The presence of these two, often incommensurate, frequencies means that Hofstadter's calculation of electron energy levels yielded some bizarre results. Hofstadter tried to make sense of this difficulty by plotting the *wave function* of the electron versus a parameter related to the ratio of the two frequencies. The plot produced a stunning fractal pattern that looks like a butterfly." I found what appears to be the/a calculation here: http://phelafel.technion.ac.il/~orcohen/butterfly.html Let me know if you find some code. - Hal Lane ######################## # hallane(a)earthlink.net ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Tony Hanmer Sent: Thursday, August 13, 2015 12:58 AM To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> Subject: Re: [Fractint] I just ran across this fractal object: Hofstadter's butterfly: Beautiful, especially the 2nd version. Any Fractint code for rendering this? On 12 August 2015 at 19:19, Hal Lane <hallane(a)earthlink.net> wrote: > I just ran across this interesting fractal object: Hofstadter's butterfly: > https://en.wikipedia.org/wiki/Hofstadter%27s_butterfly > > Be sure to see the large version of the 2nd version of the fractal... > > Yes, this is the Douglas Hofstadter of "Gödel, Escher, Bach" (1979). > > - Hal Lane > > ######################## > # hallane(a)earthlink.net > ######################## > > > > --- > This email has been checked for viruses by Avast antivirus software. > https://www.avast.com/antivirus > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

1 0

Cubby Cloudservice
by Albrecht Niekamp 13 Aug '15

13 Aug '15

Hi, Maybe you have noticed that many audio files cannot be opened. This happened as the beloved Box.com deleted all uploadings incl the source folder as they have ddecided that XP is not supported anymore. But they deleted only the contents so you did not notice unless opened. Now they all are back in top MP3 quality 320KB Dual Channel.. One listening tip: Honky Tonk Blues - 3 parts. Here´s the link again: https://www.cubbyusercontent.com/pl/MultifracArchive/_bb8cd4b47ce347b8a0669… ; Albrecht

2 1

I just ran across this fractal object: Hofstadter's butterfly:
by Hal Lane 13 Aug '15

13 Aug '15

I just ran across this interesting fractal object: Hofstadter's butterfly: https://en.wikipedia.org/wiki/Hofstadter%27s_butterfly Be sure to see the large version of the 2nd version of the fractal... Yes, this is the Douglas Hofstadter of "Gödel, Escher, Bach" (1979). - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. https://www.avast.com/antivirus

2 1

Alert
by Jim Muth 13 Aug '15

13 Aug '15

Fractal fans: As this letter shows, I'm still here. And after a 6 month break, I'm starting to feel the fractal bug stirring again. I'm not sure, but in the not too distant future I might resume the FOTD, maybe not every single day, but at least a couple times a week. So for any who might still be out there, be alerted ahead of time. JIM M

8 8

Re: [Fractint] Alert
by David Jones 12 Aug '15

12 Aug '15

FWIFLI (Fractal When I Feel Like It)? Welcome back! David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.comOn Aug 11, 2015 13:28, "Paul N. Lee" <Paul.N.Lee(a)att.net> wrote: > > Jim Muth wrote: > > > > ....I'm still here. ..... > > ....I'm starting to feel the fractal > > bug stirring again. ..... > > ....I might resume the FOTD.... > > > > Glad that you are still around, too many of us "old ones" seem to be > leaving these days (whether permanently or voluntarily). And yes, if > one has ever been bitten by the "fractal bug", there is no cure, it can > flare up at any time, but will never truly be gone. ;-) > > I agree with John Wilson, "indeed a cause for celebration", even if it > may be just a FOCTW (Fractal Of a Couple of Times a Week) or a FOFTW > (Fractal Of a Few Times a Week). :-D > > > Sincerely, > P.N.L. > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

2 1

XfractInt
by JackOfTradeZ＠comcast.net 09 Aug '15

09 Aug '15

. Over time I have ignored discussions here about xfractint since it didnt apply. After dabbling on and off for many years I have finally decided to get serious about Linux since the lab instruments I use every day at work [which cost more than my condo] run off Linux. I chose Fedora since that is the distro most often used. This ain't your daddy's Linux! It installed smoothly, and everything was up and running the 1st time I booted in. Including internet and audio, which is often the most difficult thing with windoze and usually the last I get running. I am currently learning my way around it, especially the command line. There are a few issues, most irritatingly, I can not access some folders and install some software, as Linux complains I don't have "root access". I am trying to figure that out. I assume since I installed it and I am the only singular user, I would have full access by default. What / Who would be higher than me, except God? Anyway, I want to give Xfractint a try. So the queshun is - can someone point me to the most recent distribution, and if needed, installation instructions? . JoTz [from Fedora21] .

2 1

Cubby Cloudservice
by Albrecht Niekamp 16 Jul '15

16 Jul '15

After my initial tests this ipossibly s the solution of the problem, easy to handle and install, fast, secure and hopefully without sharing problems. Also XP compatible and features 5 Giga capacity. Please test it and let me know. Thanks. ; https://www.cubbyusercontent.com/pl/MultifracArchive/_bb8cd4b47ce347b8a0669… ; Albrecht

2 1

IDrive Support Ticket #ID00689780
by Albrecht Niekamp 15 Jul '15

15 Jul '15

As filesharing does not work properly and due to lack of support I am now uninstalling IDrive. The links are not valid anymore Albrecht Niekamp

1 0

Re: [Fractint] #ID00689780: IDrive Cloudservice - Sharing
by Albrecht Niekamp 14 Jul '15

14 Jul '15

Am 14.07.2015 um 13:37 schrieb IDrive Support: > Dear Albrecht Niekamp, > > This message is in reference to ticket number: ID00689780. > > We feel that Live Chat will be a better medium of Communication in investigating this issue further. Hence, we request you to contact us through live chat support at your convenient time. > > You may initiate a live chat with us from the following link: https://www.idrive.com/support.htm > > Please provide the service ticket number in the subject line to the online technician who picks up the chat. > > Regards, > IDrive Support. Second reply with copy to the Fractint Forum I have contacted your live support two times but did not get any reaction. I also supplied my phone number in Germany but was not called back. As I think this is just an automatically generated message I am asking you again for support for the very last time. Failure to assist means you refuse and I will uninstall IDrive. Albrecht Niekamp

1 0

IDrive Cloudservice - Sharing
by Albrecht Niekamp 14 Jul '15

14 Jul '15

This is my fourth and last request for support before uninstalling in favor of a different cloud service. I will not repeat the Ticket number in order to issue a new item ; I am trying to make my personal archive available for reading and downloading to the Fractrint Foru,m copied in this message. /_Problem_/:The major part of the Forum members only sees a Log in form instead of the contents. As this is a forum login must not be required. Sharing rights duly set and saved for Read only, no password.. ; What can be done to make the contents of my archive available to ALL members. Albrecht Niekamp

1 0

Idrive Cloudseervice
by Albrecht Niekamp 13 Jul '15

13 Jul '15

I´m sorry to state that several requests to the IDrive helpdesk and to their "live" support remain unanswered. That´s the reality about their claimed customer friendliness. So far I will not uninstall IDrive as it is secure due to their encryption and they supply 5Giga in the free version. So iif you only see a log in form it´s up to you to decide if you are willing to log in in order to see and download my archive. It´s no risk, free and involves no installation. I´ll inform you about any changes. Albrecht

1 0

Albrecht's images: 14_23800-04.GIF and 13_23800-01.GIF
by Hal Lane 12 Jul '15

12 Jul '15

Albrecht's image: 14_23800-04.GIF in the MultifracArchive > New > NewGif folder at: https://www.idrive.com/idrive/sh/sh?k=p5q5b9d7e9 reminds me of a deep sea animal crawling along the sea floor. The appendages extending from the sides of its body seem like the external gills of this unusual animal: http://www.gceadvancelevel.com/wp-content/uploads/2015/01/35.jpg The color almost matches, too! Also in the same folder, 13_23800-01.GIF, appears like the spade symbol on playing cards the way Albrecht has cropped it. Interesting to me is the way this image's color palette changes in different areas, while the image structures in those areas appear to remain the same. - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

8 17

MutifracArchive - I Drive Cloudservice
by Albrecht Niekamp 06 Jul '15

06 Jul '15

*This is a remark found on internet search after 8 hours of uploading: ; Note: The Share option is available only for IDriveSync accounts with default encryption. ; You dont get any information from them, supportdesk did not reply. So IDrive is just another kick in the.... Albrecht *

1 1

Re: [Fractint] "Share option is available only for..."
by Hal Lane 06 Jul '15

06 Jul '15

> Share option is available only for... Not very user friendly to hide that little piece of information.. > ...supportdesk did not reply. They might not have enough people to properly support their service... I wonder what their "business model" is -- how do they plan to make money to pay for the electric power running their servers? - Hal (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Albrecht Niekamp Sent: Sunday, July 5, 2015 9:14 PM To: Fractint and General Fractals Discussion Subject: [Fractint] MutifracArchive - I Drive Cloudservice *This is a remark found on internet search after 8 hours of uploading: ; Note: The Share option is available only for IDriveSync accounts with default encryption. ; You dont get any information from them, supportdesk did not reply. So IDrive is just another kick in the.... Albrecht * _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Cloudservice
by Albrecht Niekamp 05 Jul '15

05 Jul '15

This is a test for another cloudservice - I Drive ; https://www.idrive.com/idrive/sync/MultifracArchive/New ; Albrecht

1 0

Re: [Fractint] I found some code...
by David Jones 04 Jul '15

04 Jul '15

Linux offers a lot of programs that do that very thing. Most image management programs can do it, too - I use KPhotoalbum to manage my 54000-some odd image collection. It can export with a number of HTML+Javascript layouts that can be uploaded to a site. Our family webhosting service includes a number of PHP-based photogallery apps; most hosting services include them. Albrecht might consider using a hosting service and domain (multifract.com?) instead of relying on services like Dropbox & its competitors. David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.com On Jul 4, 2015 1:20 PM, Hal Lane <hallane(a)earthlink.net> wrote: > > > BoxCom has deleted my XP uploads > Why on Earth would they do that? <== <== > > > It might be possible to write a php + javascript program that > steps thru all the files in a folder and construct a list of > clickable download links for each image on a web page. > The great thing about this idea is that the file/program > would be the same for every folder. > > I've never written php and javascript that complex before, though. > > I found some code that someone wrote to do this, but I don't > understand it fully... And so far I've not been able to make it work > on your site. > > I'll play with it a little more. It's doing a lot of stuff that I'm > not familiar with. > > - Hal > > (\__/) ######################## > (='.'=) # hallane(a)earthlink.net > (")_(") ######################## > > -----Original Message----- > From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of > Albrecht Niekamp > Sent: Saturday, July 4, 2015 9:10 AM > To: Fractint and General Fractals Discussion > Subject: [Fractint] MultifracArchive > > Sorry, > BoxCom has deleted my XP uploads too. > They are a just a big nuisance. > So now looking for an alternative cloud service. > Albrecht > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > --- > This email has been checked for viruses by Avast antivirus software. > http://www.avast.com > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

I found some code...
by Hal Lane 04 Jul '15

04 Jul '15

> BoxCom has deleted my XP uploads Why on Earth would they do that? <== <== It might be possible to write a php + javascript program that steps thru all the files in a folder and construct a list of clickable download links for each image on a web page. The great thing about this idea is that the file/program would be the same for every folder. I've never written php and javascript that complex before, though. I found some code that someone wrote to do this, but I don't understand it fully... And so far I've not been able to make it work on your site. I'll play with it a little more. It's doing a lot of stuff that I'm not familiar with. - Hal (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Albrecht Niekamp Sent: Saturday, July 4, 2015 9:10 AM To: Fractint and General Fractals Discussion Subject: [Fractint] MultifracArchive Sorry, BoxCom has deleted my XP uploads too. They are a just a big nuisance. So now looking for an alternative cloud service. Albrecht _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

MultifracArchive
by Albrecht Niekamp 04 Jul '15

04 Jul '15

Sorry, BoxCom has deleted my XP uploads too. They are a just a big nuisance. So now looking for an alternative cloud service. Albrecht

1 0

Box Link
by Multifrac＠t-online.de 04 Jul '15

04 Jul '15

Box.com has erroneously deleted all uploads and after my clear language intervention has reinstalled them. Here is the new link, tested: https://app.box.com/s/obdhc16wo3jg2t9nkaaxwspoxn4h3djt Albrecht

1 0

MultifracArchive
by Multifrac＠t-online.de 01 Jul '15

01 Jul '15

I´ve added two more folders with several 100 images, experimental and early MFR_images. Uploading is complete now. ; https://app.box.com/s/s0f0obe3wm593ha4vgxkfg4xizmr4azj ; Albrecht

1 0

MultifracArchive
by Albrecht Niekamp 01 Jul '15

01 Jul '15

As I am sick and tired of the problems with DropBox I have switched to Box.com who have a better reputation. Here is the link to the COMPLETE archives. ; https://app.box.com/s/s0f0obe3wm593ha4vgxkfg4xizmr4azj ; Albrecht

2 2

The Token
by Albrecht Niekamp 27 Jun '15

27 Jun '15

Hi, As some kind of legacy I´m supplying a permanent link to all previous creations accompanied by a new image. ; https://www.dropbox.com/sh/r0fhfn0b64p03d6/AACVgHmPP--2xSPYLMMD-6A2a?dl=0 ; This the link to the archives: https://www.dropbox.com/sh/njsi75xvm2vauk8/AACqEVQEK3_bCIHektHCmwdHa?dl=0 ; Albrecht ; ---------------Start Par------------------------------------------------- 35010-08 { ; The Token ; Bees-ManyMods-Secant ; Time 0.03.36.95 Reso 1280/1024 ; All parts modified + colormap nodification reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/flip/atan/sin passes=t center-mag=-46.17951536728589000/-3.30116761907637300/1.133983e+007/1/3.\ 40000016640994485/-4.49153517122213852e-007 params=-0.05825983458967864/0.3785210730307932/35010.6459576706/45235.49\ 11030602/152048.0404808048/1.1604894048/2.00482000595/0.1000003001/422.2\ 000003001/768.1000003001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 sound=off colors=0005zg<3>9xmAwnBvo<2>FrrHpsIntKluLjv<3>RbyT_yUYz<3>`PzaMzcKz<3>hC\ yjAyk8x<3>p3vq2ur1t<3>v0ow0nx0m<3>z2hz3fz5ez6c<3>zDYzFWzHV<4>wSNvUMvXK<3\ >reEqgDoiC<3>jq7ir6ht5<3>bx2`y2Zz1<3>Tz0Sz0Qy0Py0Nx0000<3>001002Dn2<3>8f\ 67d66b7<4>2RD2PF1MG<3>0EM0CN0AP<3>04V03X12Y<3>30c40e50f60h<3>A2mB3nC5pD6\ q<5>MHvNJwPLx<3>VUzXXzYZz<3>cgzeizfkzhmyioy<3>nuwpvv000qwurxtsys<3>vzowz\ nxzlxykyyjzwg<3>zrazp_znZ<3>yfSydRxbP<4>tRIsPHrMF<3>nEAlC9kA8<3>e44d33b2\ 3a12<3>W00U00S00<3>M20L30J50I61<3>DD3BF3AH4<3>6Q85S94UA<2>2`E1cF1eH1gI0i\ K0kL<3>0rR0tT0uU<3>2y_2za3zc3zd4zf } --------------------------End-----------------------------------------------

1 0

Subtle Brot
by Mike Frazier 14 Jun '15

14 Jun '15

This fractal mixes tangent and z^2. The minibrot is surrounded by a lot of irregularly shaped inside stuff that make it a little less obvious. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/subtle_brot_800_5.jpg The FractInt compatible PAR file for the image is: Subtle_Brot { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150612_1229 passes=1 float=y center-mag=0.1403000647626814/0/4167350.681273673/\ 1/0/0 params=1/-1/2/2/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=000FMMCSSC__CggCooCosCgsC_sCSsCKsCCsGGtLLuQ\ QvYYweexmlzbbwWWkaRUjKLpFGsKKsSSs__sfeumfxtgzzgxx_\ uuSssKssCksCcsCWsCSpCQiEOaGNVHLOJKKLMMPNNTPPWQQ_RR\ cUUi__oWdrGhrCcsCWsCOsCGsGCsOCsWCscCskCssCssCksCc0\ 00FMMCSSC__CggCooCosCgsC_sCSsCKsCCsGGtLLuQQvYYweex\ mlzbbwWWkaRUjKLpFGsKKsSSs__sfeumfxtgzzgxx_uuSssKss\ CksCcsCWsCSpCQiEOaGNVHLOJKKLMMPNNTPPWQQ_RRcUUi__oW\ drGhrCcsCWsCOsCGsGCsOCsWCscCskCssCssCksCc000FMMCSS\ C__CggCooCosCgsC_sCSsCKsCCsGGtLLuQQvYYweexmlzbbwWW\ kaRUjKLpFGsKKsSSs__sfeumfxtgzzgxx_uuSssKssCksCcsCW\ sCSpCQiEOaGNVHLOJKKLMMPNNTPPWQQ_RRcUUi__oWdrGhrCcs\ CWsCOsCGsGCsOCsWCscCskCssCssCksCc000FMMCSSC__CggCo\ oCosCgsC_sCSsCKsCCsGGtLLuQQvYYweexmlzbbwWWkaRUjKLp\ FGsKKsSSs__sfeumfxtgzzgxx_uuSssKssCksCcsCWsCSpCQiE\ OaGNVHLOJKKLMMPNNTPPWQQ_RRcUUi__oWdrGhrCcsCWsCOsCG\ sGCsOCsWCscCskCssCssCksCc } frm:F_20150612_1229 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2)-1,d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(z^b)*tan(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

3 2

MIDI vs WAV
by JackOfTradeZ＠comcast.net 11 Jun '15

11 Jun '15

.FYI . Folks, a WAV file is the actual (originally analog) music which has been (recorded) digitized and formatted as a computer file. It is generally the best quality sound you can get on a computer, which is why even short WAV files are quite large. . MIDI is NOT a "compressed format" like MP3 is. It is easy to convert WAV<->MP3. MP3 works by deleting so-called "redundant" frequencies, usually in the mid-range. For rock music it doesn't matter, for fine jazz and classical MP3 sux. Converting WAV to MP3 you will lose some fidelity; you can NOT then convert MP3 back to WAV and "re-gain" the lost fidelity - it is gone. . MIDI is actually a set of instructions, a program, that your audio card and software reads and uses to actually generate the music on the fly. MIDI files can be quite small, only a few Kb, yet play long music stretches. Think of MIDI as that ticker-tape thing with holes punched in it that a toy musical instrument or even a piano could "read" and then play the music. [I may be the only one here old enuf to know about those <g>]. Generally, you can NOT directly convert a WAV, MP3 or other music file into MIDI. Some software "kinda" can do it, but quality is generally not good. MIDI can easily be converted to WAV, MP3 or other formats and saved as such. I have software for that - it is readily available. .

2 1

Natural Music
by Albrecht Niekamp 11 Jun '15

11 Jun '15

Just in case sonebody is still interested, I doubt it, here´s a link with some new items. David, you requested the link but apparently you dont think it´`s worth a reply. Anyway the members of the Fractal Music forum do not share this attitude ; https://www.dropbox.com/sh/f1vllig55mknu9p/AAABDtvSpX9Sm2j5HB_PaXkIa?dl=0 ; Albrecht

5 5

Natural Music
by Albrecht Niekamp 10 Jun '15

10 Jun '15

Links deleted Publishing of deleted items prohibited Albrecht

4 6

Re: [Fractint] When I listen to Albrecht's NAMRHA44.mp3 I see...
by Albrecht Niekamp 09 Jun '15

09 Jun '15

> > > Am 09.06.2015 um 01:05 schrieb Hal Lane: >> When I listen to Albrecht's NAMRHA44.mp3 I see orange-clad >> monks dancing, holding oversized tambourine-like drums, and >> striking them with short, heavy wooden sticks. >> >> The place they're dancing seems to be next to an old, old exotic >> stone structure -- like Angkor Wat in Cambodia. > There is an interesting and controversial discussion going on in the fractal forums and I definetely would be happy if you could take part, possibly your login is still valid http://www.fractalforums.com/fractal-music/ ; Revision: Fractal Forums Topic deleted. Albrecht

2 2

When I listen to Albrecht's NAMRHA44.mp3 I see...
by Hal Lane 08 Jun '15

08 Jun '15

When I listen to Albrecht's NAMRHA44.mp3 I see orange-clad monks dancing, holding oversized tambourine-like drums, and striking them with short, heavy wooden sticks. The place they're dancing seems to be next to an old, old exotic stone structure -- like Angkor Wat in Cambodia. - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Natural Music
by Hal Lane 08 Jun '15

08 Jun '15

NAM80b44.mp3 seems very "bouncy" and happy to me on initial listening -- perhaps due to its woody higher-pitched "hammered strokes." This piece is not for meditation, I think. It's more for raising your mood. Very nice, Albrecht! - Hal Lane ######################## # hallane(a)earthlink.net ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Albrecht Niekamp Sent: Monday, June 8, 2015 6:49 AM To: Fractint and General Fractals Discussion Subject: [Fractint] Natural Music Just in case sonebody is still interested, I doubt it, here´s a link with some new items. David, you requested the link but apparently you dont think it´`s worth a reply. Anyway the members of the Fractal Music forum do not share this attitude ; https://www.dropbox.com/sh/f1vllig55mknu9p/AAABDtvSpX9Sm2j5HB_PaXkIa?dl=0 ; Albrecht _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Audio wars.
by John Wilson 05 Jun '15

05 Jun '15

As my hearing is impaired, I'm not interested in Fractal Music... my hearing aids don't allow me this luxury. I miss music... I'd like just as much to miss the temper tantrums exhibited in this Fractint venue. I guess it's difficult for devotees of the art to understand that many of us do not eat and sleep fractals. I'd venture to guess that for the majority of readers they are a sideline—to be investigated occasionally when something new pops up and we are not too busy. Any artist screaming "look at me" should remember that the truly great were frequently unappreciated until long after their demise. My two cents, John W.

3 2

natural music
by Multifrac＠t-online.de 05 Jun '15

05 Jun '15

due to overwhelming feedback I give up. No nore posts from me, project willcontinue on a different location ; Albrecht

3 6

Re: [Fractint] natural music
by David Jones 05 Jun '15

05 Jun '15

What we who email/blog/tweet/instagram/facebook anything should be most prepared for is the grand response of ... silence. I've not listened to Bill's or Albrecht's fractal music yet, but I save the emails with the intention of listening. Similarly for images. David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.com On Jun 4, 2015 8:54 AM, Bill Jemison <bill.jemison(a)gmail.com> wrote: > > changed attitude? not sure about that...I have always tried to separate > criticism of my audio fractals from crits of me personally. I hope that > others, including you, can do the same. Whatever I think of your fractal > music has nothing to do with what I think of you personally. I don't know > you other than through your posts. > > I do know that when one decides to post something online we should be > prepared for, and be ok with, critiques...whether positive or negative. > Because, in the past, you have seemed to take my crits of your work as > something very personal, I have just decided it would be better to refrain > from commenting on them. I will continue to listen as you post your music > (visual fractals have very little interest for me after they are completed > - with the exception of animated fractals) but I'll keep my feelings, > positive or negative, to myself unless asked directly. > > I definitely intend to post some of my audio fractals - feedback +/- > encouraged. It should be an interesting contrast in styles - if anyone is > interested. > Bill > > On Wed, Jun 3, 2015 at 1:51 PM, Multifrac(a)t-online.de <Multifrac(a)t-online.de > > wrote: > > > Am 02.06.2015 um 23:34 schrieb Bill Jemison: > > > >> hate to see you pick up your marbles and leave. I thought you had some > >> really good feedback and although I don't feel comfortable critiquing your > >> music per se, I did listen to your latest and did notice some subtle > >> differences from prior files. > >> > > It´s good to see that you´ve changed your attitude, let´s see if their is > > a base > > for cooperation. As Paul said there are "silent" users interested in my > > fractal > > music and my creations generally will see if there is any chance to revive > > the > > dead man. Will give you my alternate location later. > > Of course it´s ok to show my music on your website, after all Natural > > Music s a new > > concept and a unique kind of fractal music that avoids to be compared to > > commerciaL junk. > > Listen to the new item later today. > > Albrecht > > > > > > _______________________________________________ > > Fractint mailing list > > Fractint(a)mailman.xmission.com > > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Natural Music
by Albrecht Miwkamp 05 Jun '15

05 Jun '15

exit

1 0

Natural Music - The Creek
by Multifrac＠t-online.de 30 May '15

30 May '15

The Creek : Imagine... a clear forest and you´re dozing at the banks of small river. Listen to the sound of the water rippling through the stones and let yourself get carried away ... Images like that I had in mind creating the Natural Music. The Forest Lord picture may help you to tune in. : The Fractal is a beautiful sample of Jim´s Mandel images. If he is listening maybe he can find the parameters, it´s an old one. : It strikes me how close the music is to the basic fractal. Enjoy the numberless variations and let yourself get carried away. ; https://www.dropbox.com/sh/7evkupcculvwp36/AAAsW97o7zkswB0XZfog0Amga?dl=0 ; Albrecht

1 0

Re: [Fractint] Natural Music - Summer Breeze
by Multifrac＠t-online.de 29 May '15

29 May '15

"I have another more lively version, maybe later." This is to inform you that this version now is onlinw. The main difference is the fractal rhythm which now has 1/16 Triplet as shifting base Albrecht

1 0

Natual Music - Summer Breeze
by Multifrac＠t-online.de 29 May '15

29 May '15

Natural Music - Summer Breeze ; Digital Music with a human touch - Even if you dont like Fractal Music this one will possibly change your mind I think. Correct me if Im wrong. The Natural Music algorithm sticks much closer to the basic fractal image and a harmonic beautiful image will generate a similar listening experience. With one small adjustment the converting algorithm is the same as yesterday. I have another more lively version, maybe later. ; https://www.dropbox.com/sh/d67aze72i17ezfm/AACkfd74LknqQMuoOiCAU88ga?dl=0 ; The mp3 is 320kb, high quality, dual channel. For conversion from midi the Weeds GM3 soundfont is used, which is the best one available. ; Albrecht

1 0

Fwd: Natural Music
by Timothy Wegner 28 May '15

28 May '15

Albrecht is back but having trouble posting, so I am helping him out. Tim ======================== HI, Having returned from my 2 months trip I have to face the fact that in the meantime not a single new fractal has been presented, so the forum has to be considered finalized. but on the other hand I managed on earlier occasions to reanimate the dead man. : So let´s give it one more try, I have something to contribute to lighten the task. The multifractal project is about finished successfully and the question is what to do next - : It is generally accepted that fractals play an important part in our universe and the idea that something as complex as the mandelbrot has not a certain task is out of the question. If you look around yourself in a natural surrounding not killed by human dirt you detect that the components to a high degree are fractal, the biology and even more the inanimate parts of nature - water, air, earth, fire and the like. : Of course these components produce sounds - maybe inspiring or exciting. Listen to wind, raindrops or sounds of the sea which quite often are used to enhance or play a part in music. They may contain melodical or rhythmical elements which change if you´re listening for some time. : I´m trying to produce music consisting of similar elemnts with no predefined melody or rhythm which nevertheless urges you to listen, detect them and dive into the acoustical experience. Listening again and again you may detect different components so you have the feeling that it is not the same music anymore and want to listen again. : Especially produced multifractal images with numerous different shapes and colors are converted into sound using the RGB values of single pixels as source. A square IFS is used for scanning. An enhanced version of my fractal rhythm supplies the musical progress. It is a shifting rhythm that NEVER repeats, so the "melodical" elements also change. A sophisticated formation makes it possible that every voice can have any pitch or length. : The music is generated by an automatic algorithm which does not reqire any manual input. The final result definetely is fractal music: NATURAL MUSIC not to be confounded with nature music. The scale is "E"- Minor Pentatonic, measures 1/1 16 triplets. The Image is a manowar image produced with the latest MFR14 patch, both included in the link. ; https://www.dropbox.com/sh/f8dfjd11uqs7o1a/AAC2t9_rUYrTPSTEC3oG6XZ5a?dl=0 ; The music is an unedited first version, more advanced music will follow if there is some feedback ; Albrecht Niekamp

3 2

New Mailaddress
by Multifrac＠t-online.de 28 May '15

28 May '15

This is a test as I have changed the Fractint address. ; Albrecht

1 0

You are not Alone
by Ram Peloquin 21 May '15

21 May '15

[image: Dancing With The Hologram 2]

1 0

Re: [Fractint] Mandel Machine (Roger Kaufman)
by Roger Kaufman 20 May '15

20 May '15

Hi Richard, > ./xfractint @test1.par/VsionOfaDistantSea I found how to get this to work without dumping. It is looking for the formula file where Jim specified his local file. In the DOS verison this does not cause a problem. But in xfractint it needed to be commented out. VsionOfaDistantSea { ; time=0:03:15.00 SF5 at 2000MHZ reset=2004 type=formula ; formulafile=basicer.frm formulaname=SliceJulibrot5 center-mag=+0.015260972\ ... After running this command for several hours it only produces the top left portion of the image. Doing several runs, it never gets past this point. I uploaded the image so it can be seen. This same command works to produce 4800x3600 when generating Poachers_Afoot which generated in 36 seconds. ./xfractint -disk -geometry 4800x3600 batch=yes savename=work/test.gif "@test1.par/VsionOfaDistantSea" http://www.interocitors.com/tmp/test.gif My sstools.ini is below which might help [xfractint] inside=0 map=maps/default.map ifsfile=ifs/fractint.ifs parmfile=pars/fractint.par lfile=lsystem/fractint.l formulafile=formulas/fractint.frm autokeyname=key/auto.key ;filename=./work savename=./work printfile=./work workdir=./work tempdir=./work savetime=60 ;video=f3 exitnoask=yes float=yes ;fpu=387 ;curdir=yes ;printer=pa orgfrmdir=./ORGFORM Roger

2 3

Test
by Jim Muth 19 May '15

19 May '15

Fractal fans: I'm still here, but I have received no e-mails from the list in a couple weeks. This is a test to see if the list is still alive and if I'm still subscribed. Jim M

5 5

Test Post ... Alive in Alaska
by David W Riccio 19 May '15

19 May '15

Test Post ... Alive in Alaska -- -David

1 0

Re: [Fractint] Fractint Digest, Vol 147, Issue 9
by JackOfTradeZ＠comcast.net 16 May '15

16 May '15

. ""What about the issue of the graphics card (or onboard chip) needing to support the DOS VESA video modes used by Fractint?"" Any P2 or P3 box as is (as was) will have a graphics card from that era, they all work(ed) fine for me - never had a problem. It seems that the older cards actually give better video options with FractInt than the newer ones - I have noticed many times. Obviously new cards are better in all respects, I think it is a DOS/compatibility issue. I just bought a state-of-the-art video card (circa 2003) for $10 and it gives me 1600 res option. As for chips - I have determined that Athlon64 works better than Intel P4. P2 and P3 work the best of all. .

2 1

Re: [Fractint] Mandel Machine (Roger Kaufman)
by Roger Kaufman 14 May '15

14 May '15

Hi Richard, > ./xfractint @test1.par/VsionOfaDistantSea This par, which contains the formula core dumps. When I used "Poachers_Afoot" which uses a system formula it works. ./xfractint "@test2.par/Poachers_Afoot" > I can send you my scripts that run from a cron job if you want. The > relevant part is this: > > bin/xfractint -disk -geometry $2x$3 \ > batch=yes savename=$stream.gif "@$stream.par/tmp" > > The batch=yes makes it render the image and then exit immediately > after it is done. I am having trouble when the geometry gets top big. It immediately writes a blank gif and exits. I don't have time to debug now but I could put in debug statements to see where it fails. It may be a problem due to the fact I am running in a virtual machine instead of natively. Interesting, once (but only once) this command worked by generating the image of 1600x1200. ./xfractint -disk -geometry 1600x1200 batch=yes savename=test.gif "@test2.par/Poachers_Afoot" How is geometry supposed to work. If I tried 800x800 it instead generated an image which was 1068x800. Maybe my geometry isn't legal? Roger

2 1

Re: [Fractint] 91 year old man wants fractint help!
by Timothy Wegner 14 May '15

14 May '15

For everyone's information , Rivka (daughter of the Fractint fan mentioned in the quoted message below) is now on this list. So between the list and one of the list members who is helping off-list, maybe we can get Rivka's father set up. Rivka, don't hesitate to ask questions here or report progress! Tim On Tue, May 12, 2015 at 7:25 PM, Timothy Wegner <tim(a)tswegner.net> wrote: > I just got the following email, which I found very touching: > > ================= > Dear Mr. Wegner, > > I am writing on behalf of of my 91-year-old father. He has been using > Fractint for decades to create art like the attached. > > Unfortunately, computers breakdown and we have been trying, > unsuccessfully, to create a vintage/legacy system that will run the DOS > version of Fractint. > > I recently purchased a vintage Dell laptop running windows 95 from eBay. > It is not working for him. My father seems to remember a command using the > keystroke B which removes the color from the fractal and only leaves > an outline. He then imports this image into Windows Paint in order to > resize it for the canvas. We cannot find that functionality now. > > So, my questions to you are: can you recommend the components of a system > that we could put together to get my father back in business using the DOS > version of Fractint? Do you know of a command in the program that removes > the color? And finally, are you the best person for us to consult with on > this, or can you recommend someone? > > On behalf of my father and my four siblings who he has trying to tackle > this problem, I thank you for your time. > > Sincerely, > Rivka Morgan-Sherman > ======================== > > I am telling him that a Win95 computer should work fine. I am not clear > from his email why Win95 is not working for him. However, I am not sure > what the "B" command is he is referring to. Any ideas? > > I am inviting him to join the list. I am willing to help but I suspect > some of you who are currently using fractint might be better. Also, if any > of you would like to correspond with this gentleman, just let me know > off-list. > > Tim >

1 0

91 YO FractalNaut
by JackOfTradeZ＠comcast.net 13 May '15

13 May '15

. Do what I do, what I suggest many times to people on this list with the same problem, but no one ever does it. Purchase a legacy system, either locally at one of the (many) brick and mortar PC repair outfits, or online (search - there are so many). Get a Pentium-3 at ~700-900 MHZ - they work the best. You shouldn't shell out more than 100-200 $ if that; sometimes much less even. Install DOS, or Win9X ; use a fresh HD or simply format the one that came with it. Run FractInt and have fun - just like the good old days. If you get to Win9X then I can tell you how to configure it so it boots to DOS and STOPS. If using just DOS you can transfer files with a USB Mem stick. In BIOS, set the flag for "legacy USB support" and it will work! Since DOS is no longer supported etc., I think it is legal to share the installation files. I can post the original DOS 6.22 files [3 floppies] on my server; you can download and use to install. Can't do with Win9X. Although I have the Disks for 95 and 98. .

2 1

91 year old man wants fractint help!
by Timothy Wegner 13 May '15

13 May '15

I just got the following email, which I found very touching: ================= Dear Mr. Wegner, I am writing on behalf of of my 91-year-old father. He has been using Fractint for decades to create art like the attached. Unfortunately, computers breakdown and we have been trying, unsuccessfully, to create a vintage/legacy system that will run the DOS version of Fractint. I recently purchased a vintage Dell laptop running windows 95 from eBay. It is not working for him. My father seems to remember a command using the keystroke B which removes the color from the fractal and only leaves an outline. He then imports this image into Windows Paint in order to resize it for the canvas. We cannot find that functionality now. So, my questions to you are: can you recommend the components of a system that we could put together to get my father back in business using the DOS version of Fractint? Do you know of a command in the program that removes the color? And finally, are you the best person for us to consult with on this, or can you recommend someone? On behalf of my father and my four siblings who he has trying to tackle this problem, I thank you for your time. Sincerely, Rivka Morgan-Sherman ======================== I am telling him that a Win95 computer should work fine. I am not clear from his email why Win95 is not working for him. However, I am not sure what the "B" command is he is referring to. Any ideas? I am inviting him to join the list. I am willing to help but I suspect some of you who are currently using fractint might be better. Also, if any of you would like to correspond with this gentleman, just let me know off-list. Tim

2 1

Re: [Fractint] Mandel Machine (Roger Kaufman)
by Roger Kaufman 12 May '15

12 May '15

Hi Richard, > My pages render the images at 1600x1200 with 3x oversampling, so the > actual rendered dimensions are 4800x3600. My system has this processor : 0 vendor_id : GenuineIntel cpu family : 6 model : 60 model name : Intel(R) Core(TM) i7-4770K CPU @ 3.50GHz stepping : 3 microcode : 0x19 cpu MHz : 3506.459 cache size : 6144 KB physical id : 0 siblings : 2 core id : 0 cpu cores : 2 apicid : 0 initial apicid : 0 fpu : yes fpu_exception : yes cpuid level : 5 wp : yes flags : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush mmx fxsr sse sse2 ht syscall nx rdtscp lm constant_tsc rep_good nopl pni ssse3 lahf_lm bogomips : 7012.91 clflush size : 64 cache_alignment : 64 address sizes : 39 bits physical, 48 bits virtual power management: I have been trying to load the par in disk video mode and it core dumps right away. The planned command is ./xfractint -disk @test.par/VsionOfaDistantSea -geometry 4800x3600 Trying this with the default fractal does not core dump, but at such a large window, how do you get the dialog that it is done? I just guessed at it as I assumed it was done right away. I pressed 's' to save it and then escape and 'y' to exit. Might there be a way of specifying the output file on the command line? Do you simply resize the image with an image editor afterwards?

2 1

Re: [Fractint] Mandel Machine (Roger Kaufman)
by Roger Kaufman 11 May '15

11 May '15

> I will try to find one of Jim Muths fractals where he documents the generation time. I will try it under Dosbox then under the Linux version after understanding the local environment. I have some learning to do so this may be a while. I tried the first fractal on this page... View of a Distant Sea. The time given on this image was 4+ hours although they don't give what environment this is. That kind of time is reliably assumed to be on a Dos system in some way. http://user.xmission.com/~legalize/fractals/fotd/2014/11/index.html I started it in DosBox configuration quite some time ago and it is almost done. Estimated time will be about 3 hours. Meanwhile over in Ubuntu Linux in the Oracle virtual machine (Windows 8 host, Ubuntu 64 guest), it took 2 minutes and 11 seconds. I ran it twice and it was within milliseconds of 2:11 both times. I compiled the latest xfractint and was running it in a local directory. Resolution was 800x600x256 in both tests. Just for the record my relevant hardware. This machine was built about 1 year ago. Asus Z87-A DDR3 1600 LGA 1150 Motherboard Intel Core i7-4770K Quad-Core Desktop Processor Corsair Vengeance Pro 32GB 4 x 8GB DDR3 2400MHz C11 Memory Kit Cooler Master Hyper 212 EVO XFX CORE Edition HD7850 860MHz 2GB DDR5 2x Note that at no time did fans spin up. I did some hunting to try to find other ways to generate the image. I tried ChaosPro which wasn't very compatible. Once I got the par and formula in (I had to edit) I got a blank image. The program hasn't been updated since 2010 so it seems abandoned. Uninstalled. I don't want to buy or try Ultrafractal. It also hasn't been updated in years. That being said, there are no freeware fractint compatible fractal programs. I had said that Fractint was legacy, but now that I see the work having been done on xfractint I take that back. Its the only way to go.

2 1

Re: [Fractint] Mandel Machine (Roger Kaufman)
by JackOfTradeZ＠comcast.net 10 May '15

10 May '15

. You got it! I discovered long ago that WHERE you zoom in makes a BIG difference in speed; the "chaotic" areas clearly take more time (iterations) since that is needed to distinguish the points and pixels. Obviously, the closer you are to a "lake" area the greater the chaos. Note that many deep zooms on the web are zooming into the west needle ..... [I am guilty of that also <G>]. Now waiting for a truly refined and debugged XFractInt to give me the final reason I need to get into Linux ... .

1 0

Re: [Fractint] Mandel Machine
by Roger Kaufman 09 May '15

09 May '15

On 5/9/2015 2:00 PM, fractint-request(a)mailman.xmission.com wrote: > I would like to give Mandel Machine a try, but I don't have 64bit WinDoZe, and it looks like MM doesn't have a 32bit version. > > I would try it near the point where the 2 main bulbs intersect. It is very difficult to access with FractInt or any other fractal program. I did one zoom-in to that point and it took forever to get even to E+12. > > Also, MM says it has an iteration limit of 400 million - it needs to do better than that for infinite zooms. FractInt still wins with it's 2.1 BILLion max iter! MM seems to be nice and speedy but maps are a nuisance. You can import most images (literately pictures) and form a map by sampling the colors from it. The closest I could get to Fractint's default map was to capture the image of the default scene and sample that and it wasn't very good. I wonder if the MM developer could include the default Fractint map in the list? He has Ultrafractal's default map so it seems only fair. MM breaks down at being speedy in areas around the bulbs with the background detritus (I think Jim Muth had a better description here... high iteration background stuff?). I believe for the MM deep zoom video they hung around Scepter Valley were there wasn't so much of this. It seems even with the new math, if all the pixels in a scene are chaotic, it takes similarly as long to calculate the image as just plain iterating. Fractint is still king imho. I have been a long time user of Ubuntu Linux run under the freeware Oracle VM Virtualbox. I was just looking at xfractint package. While it needs some work, I am truly impressed. The performance is simply super. The display had a refresh problem but moving the window a tad refreshed it (this might be a problem caused by running under the VM). Many fractals were already done in just a few seconds. The keyboard menu was nearly the same. If I new the directory structure for the local files I would relocate what I have from dosbox over to Linux. There are differences in the Linux world that don't make sense from the Dos world. e.g. to change resolution, under the delete key it would (ideally) just change the windows size nicely for you. I believe that it could even have the color rotation by refreshing the image after each color change. (I've seen this work under GLUT programming but I am getting into too much tech). If a stone soup approach could be made to develop Fractint on Linux it would be one super program. It already is in many ways, it just needs a little honing. Seeing what I have seen it should the primary platform for development. I will try to find one of Jim Muths fractals where he documents the generation time. I will try it under Dosbox then under the Linux version after understanding the local environment. I have some learning to do so this may be a while.

1 0

Mandel Machine
by JackOfTradeZ＠comcast.net 09 May '15

09 May '15

. I would like to give Mandel Machine a try, but I don't have 64bit WinDoZe, and it looks like MM doesn't have a 32bit version. I would try it near the point where the 2 main bulbs intersect. It is very difficult to access with FractInt or any other fractal program. I did one zoom-in to that point and it took forever to get even to E+12. Also, MM says it has an iteration limit of 400 million - it needs to do better than that for infinite zooms. FractInt still wins with it's 2.1 BILLion max iter! .

1 0

Re: [Fractint] Slashdot deep zooming
by Roger Kaufman 08 May '15

08 May '15

Paul wrote... > I have it listed within my database of fractal applications and their users. But my online listing only shows a small number of the actual total available, because of the quantity involved (over 600). I list only those programs with the most users, starting at the top of the list and working my way down. I don't think much gets past you, Paul, and I thought you may have known of it. David wrote... > I was going to test that since I have 64-bit Java on 64-bit Linux, but > it looks like it's Windows-only? From what I've seen it has to be developed in Windows so it is probably stuck in Windows. There is no problems created from having 64-bit java and 32-bit java both installed in Windows. So I have tried Mandel Machine. Upping the iteration limits really got my PC fans going. It is based on a new concept of generating the Mandelbrot fractal so I did some research on it. Apparently there has been some recent advances in fractal math. Pixels are calculated based on values from adjacent pixels. But this wasn't always giving valid values. Last year there was a breakthrough to get rid of these glitches, although they have to be found first then corrected. Not being highly adept in math, this is all I know. http://fractalmonster.deviantart.com/journal/New-Revolutionary-Algorithm-fo… http://dinkydauset.deviantart.com/journal/Perturbation-for-the-Mandelbrot-s… There is another program that also uses the new algorithm but it is also a windows program. http://chillheimer.de/kallesfraktaler/ The outstanding question is whether this is trickery or not. If the values end up being the same at each coordinate as the hard calculations then it really is a breakthrough. The major limitation then is that this only works for the Mandelbrot fractal. For that reason making zoom movies of various fractals with Fractint is still quite alive and well.

2 1

Re: [Fractint] Slashdot deep zooming
by Roger Kaufman 08 May '15

08 May '15

Hey JOT, On 5/7/2015 2:00 PM, fractint-request(a)mailman.xmission.com wrote: > I suspect treachery. Just think about it - the math behind each Mandelbrot pixel. And doing that with a number with hundreds or thousands of decimals. No. > > There are "shortcut" methods and algorithm hacks to do it , like "interpolating" between 2 images. I am a purist - do it right or it don't count! > > FractInt has some real tight "C" and "ASM" code - and it took me 3 years on several systems to get past E+100. It is possible. Looking into his discussion area he mentions "Mandel Machine". https://www.youtube.com/channel/UCsRbcv18VcWJVtfAtbKV1Vw/discussion Mandel Machine looks like it is a high precision fractal explorer which I don't see on Paul Lee's list. Looking at the history they mention using 80 bit precision. I have tried running it but it uses 64 bit Java and I have 32 bit. I am debating installing 64 bit as the claim they can co-exist but I want to do more research on that. http://web.t-online.hu/kbotond/mandelmachine/ There are ways to get much higher, even open ended precision. The GMP library can do this and I am sure while they have made it efficient, there has to be payback to performance. https://gmplib.org/ While I have the utmost respect for Fractint, it as a legacy system. For any fractal program writers out there, this question. Can your program exceed the efficiency of Fractint, i.e. draw a fractal faster at the same resolution? If so, what resources did you use to do it?

3 2

Re: [Fractint] Slashdot deep zooming; Calculation efficiency
by David Jones 08 May '15

08 May '15

Plus access to more memory and faster access to it (vs DOS' extended/expanded method)? David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.com On May 7, 2015 6:47 PM, Hal Lane <hallane(a)earthlink.net> wrote: > > > For any fractal program writers out there, this question. > > Can your program exceed the efficiency of Fractint, i.e. > > draw a fractal faster at the same resolution? > > If so, what resources did you use to do it? > > I'm told (I forget by whom) that the primary speedup used > in today's fractal programs is using multiple CPU cores > simultaneously... > > - Hal Lane > > ######################## > # hallane(a)earthlink.net > ######################## > > -----Original Message----- > From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of > Roger Kaufman > Sent: Thursday, May 7, 2015 2:46 PM > To: fractint(a)mailman.xmission.com > Subject: Re: [Fractint] Slashdot deep zooming > > Hey JOT, > > On 5/7/2015 2:00 PM, fractint-request(a)mailman.xmission.com wrote: > > I suspect treachery. Just think about it - the math behind each Mandelbrot > pixel. And doing that with a number with hundreds or thousands of decimals. > No. > > > > There are "shortcut" methods and algorithm hacks to do it , like > "interpolating" between 2 images. I am a purist - do it right or it don't > count! > > > > FractInt has some real tight "C" and "ASM" code - and it took me 3 years > on several systems to get past E+100. > > It is possible. > > Looking into his discussion area he mentions "Mandel Machine". > > https://www.youtube.com/channel/UCsRbcv18VcWJVtfAtbKV1Vw/discussion > > Mandel Machine looks like it is a high precision fractal explorer which I > don't see on Paul Lee's list. Looking at the history they mention using 80 > bit precision. I have tried running it but it uses 64 bit Java and I have 32 > bit. I am debating installing 64 bit as the claim they can co-exist but I > want to do more research on that. > > http://web.t-online.hu/kbotond/mandelmachine/ > > There are ways to get much higher, even open ended precision. The GMP > library can do this and I am sure while they have made it efficient, there > has to be payback to performance. > > https://gmplib.org/ > > > While I have the utmost respect for Fractint, it as a legacy system. For any > fractal program writers out there, this question. Can your program exceed > the efficiency of Fractint, i.e. draw a fractal faster at the same > resolution? If so, what resources did you use to do it? > > > > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > --- > This email has been checked for viruses by Avast antivirus software. > http://www.avast.com > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Re: [Fractint] Slashdot deep zooming; Calculation efficiency
by Hal Lane 08 May '15

08 May '15

> For any fractal program writers out there, this question. > Can your program exceed the efficiency of Fractint, i.e. > draw a fractal faster at the same resolution? > If so, what resources did you use to do it? I'm told (I forget by whom) that the primary speedup used in today's fractal programs is using multiple CPU cores simultaneously... - Hal Lane ######################## # hallane(a)earthlink.net ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Roger Kaufman Sent: Thursday, May 7, 2015 2:46 PM To: fractint(a)mailman.xmission.com Subject: Re: [Fractint] Slashdot deep zooming Hey JOT, On 5/7/2015 2:00 PM, fractint-request(a)mailman.xmission.com wrote: > I suspect treachery. Just think about it - the math behind each Mandelbrot pixel. And doing that with a number with hundreds or thousands of decimals. No. > > There are "shortcut" methods and algorithm hacks to do it , like "interpolating" between 2 images. I am a purist - do it right or it don't count! > > FractInt has some real tight "C" and "ASM" code - and it took me 3 years on several systems to get past E+100. It is possible. Looking into his discussion area he mentions "Mandel Machine". https://www.youtube.com/channel/UCsRbcv18VcWJVtfAtbKV1Vw/discussion Mandel Machine looks like it is a high precision fractal explorer which I don't see on Paul Lee's list. Looking at the history they mention using 80 bit precision. I have tried running it but it uses 64 bit Java and I have 32 bit. I am debating installing 64 bit as the claim they can co-exist but I want to do more research on that. http://web.t-online.hu/kbotond/mandelmachine/ There are ways to get much higher, even open ended precision. The GMP library can do this and I am sure while they have made it efficient, there has to be payback to performance. https://gmplib.org/ While I have the utmost respect for Fractint, it as a legacy system. For any fractal program writers out there, this question. Can your program exceed the efficiency of Fractint, i.e. draw a fractal faster at the same resolution? If so, what resources did you use to do it? _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Slashdot deep zooming
by JackOfTradeZ＠comcast.net 07 May '15

07 May '15

. I suspect treachery. Just think about it - the math behind each Mandelbrot pixel. And doing that with a number with hundreds or thousands of decimals. No. There are "shortcut" methods and algorithm hacks to do it , like "interpolating" between 2 images. I am a purist - do it right or it don't count! FractInt has some real tight "C" and "ASM" code - and it took me 3 years on several systems to get past E+100. WTF .

1 0

Re: [Fractint] Test
by James R McKenzie 06 May '15

06 May '15

Still here also (in lurker mode). -----Original Message----- >From: alex dukay <alex.dukay(a)bell.net> >Sent: May 6, 2015 11:26 AM >To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com> >Subject: Re: [Fractint] Test > >I am here as well >Alex Dukay >> On May 6, 2015, at 2:45 AM, David Jones <gnome(a)hawaii.rr.com> wrote: >> >> Alive here but haven't seen anything but John's note below for awhile. >> >> David W. Jones >> gnome(a)hawaii.rr.com >> authenticity, honesty, community >> http://dancingtreefrog.com >> >> On May 5, 2015 3:20 PM, John Wilson <1stdiscus(a)gmail.com> wrote: >>> >>> Alive maybe. ZZZ ZZZ ZZZ. >>> >>> On 5 May 2015 at 14:23, Jim Muth <jimmuth(a)earthlink.net> wrote: >>> >>>> Fractal fans: >>>> >>>> I'm still here, but I have received no e-mails >>>> from the list in a couple weeks. This is a test >>>> to see if the list is still alive and if I'm >>>> still subscribed. >>>> >>>> Jim M >>>> >>>> >>>> >>>> _______________________________________________ >>>> Fractint mailing list >>>> Fractint(a)mailman.xmission.com >>>> https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint >>>> >>> _______________________________________________ >>> Fractint mailing list >>> Fractint(a)mailman.xmission.com >>> https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint >> _______________________________________________ >> Fractint mailing list >> Fractint(a)mailman.xmission.com >> https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > >_______________________________________________ >Fractint mailing list >Fractint(a)mailman.xmission.com >https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Slashdot deep zooming post
by JackOfTradeZ＠comcast.net 06 May '15

06 May '15

. Yeah he's a bit behind the curve; I made the first "universe" viddie to E+27 over 10 years ago. It took 3 years to render my deepest zoom to E+112. I don't think it's practical to try E+1600 or more with fractint. On youtube and elsewhere on the web there are zooms claiming to be in the E+(thousands) range; but I think they use "trickery" to do it. .

3 2

Re: [Fractint] Test
by David Jones 06 May '15

06 May '15

Alive here but haven't seen anything but John's note below for awhile. David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.com On May 5, 2015 3:20 PM, John Wilson <1stdiscus(a)gmail.com> wrote: > > Alive maybe. ZZZ ZZZ ZZZ. > > On 5 May 2015 at 14:23, Jim Muth <jimmuth(a)earthlink.net> wrote: > > > Fractal fans: > > > > I'm still here, but I have received no e-mails > > from the list in a couple weeks. This is a test > > to see if the list is still alive and if I'm > > still subscribed. > > > > Jim M > > > > > > > > _______________________________________________ > > Fractint mailing list > > Fractint(a)mailman.xmission.com > > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

2 1

I'm alive, but working like three one-armed paper hangers...
by Hal Lane 06 May '15

06 May '15

I'm alive, but working like three one-armed paper hangers... - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Slashdot deep zooming post
by Timothy Wegner 20 Apr '15

20 Apr '15

I belatedly noticed this post on slashdot that "Mandelbrot Zooms Now Surpass the Scale of the Observable Universe". See: http://science.slashdot.org/story/15/04/19/218218/mandelbrot -zooms-now-surpass-the-scale-of-the-observable-universe While the zoom linked in the slashdot post is really nice, the slashdot headline, as everyone here knows, is a bit silly, since Fractint has had the capability of 10^1600 for twenty years now. That said, using Fractint to make a fine 10^1600 animated zoom would be challenging, to say the least..

1 0

pr_2-2-2_J
by Mike Frazier 16 Apr '15

16 Apr '15

I released a new version of Fracton with a unified user interface and an improved color editor. The fractal I am posting today came from a search I started back in 2012. I was experimenting with a 3 term parallel resistor formula and I tried moving the terms along the imaginary axis instead of the real axis that I usually use. Moving the terms created a lot of interesting parent fractals but one alignment in particular stood out. The colors are from two color maps in Paul Lee's map collection. I used Fracton's new color editor to combine the maps and fit them to the fractal. I liked how the purple areas look like a meandering river. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/pr_2-2-2_J_1200_5.jpg The FractInt compatible PAR file for the image is: pr_2-2-2_J { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150409_1343 passes=1 float=y center-mag=-9.290328008454884/0/983.2889626222531/\ 1/0/0 params=0/6.16666666/0/0/0/0/0/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=22376BCAIHEQLIXQMdVQk_UsbYuYUmUQePMYKHQFDIA\ 9A65223327B2AI2DQ1HX1Kd1Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C\ 344000862HC5PI7XPAdWDlbGthIxjIrfHj`FcVCWPAOJ8GD587\ 300030681EC2MG2TK3`P4hT4pY5xW5tR4lN3eJ3YE2Q92I50A1\ 02630E81MD1VH1bM2jR2rW2z_2rW2jR1bN1WI1OE0G90840000\ 2864GC7OIAVOCbVFj`HrgKzmHrfFj`CcVAWO7OI4GC28622376\ BCAIHEQLIXQMdVQk_UsbYuYUmUQePMYKHQFDIA9A65223327B2\ AI2DQ1HX1Kd1Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C344000862HC5\ PI7XPAdWDlbGthIxjIrfHj`FcVCWPAOJ8GD587300030681EC2\ MG2TK3`P4hT4pY5xW5tR4lN3eJ3YE2Q92I50A102630E81MD1V\ H1bM2jR2rW2z_2rW2jR1bN1WI1OE0G908400002864GC7OIAVO\ CbVFj`HrgKzmHrfFj`CcVAWO7OI4GC28622376BCAIHEQLIXQM\ dVQk_UsbYuYUmUQePMYKHQFDIA9A65223327B2AI2DQ1HX1Kd1\ Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C344000862HC5PI7XPAdWDlbG\ thIxjIrfHj`FcVCWPAOJ8GD587300030681EC2MG2TK3`P4hT4\ pY5xW5tR4lN3eJ3YE2Q92I50A } frm:F_20150409_1343 { ; Similar to the parallel resistance formula z=0,c1=pixel-p1,c2=pixel+p1,c3=pixel: f1=z*z+c1, f2=z*z+c2, f3=z*z+c3, z=1/(1/f1+1/f2+1/f3), |z|<100 } -- Mike Frazier www.fracton.org

2 3

Double Bubbles
by Mike Frazier 14 Apr '15

14 Apr '15

This fractal is from the same formula that I posted a few days ago. I like the bubbles around the double minibrot. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/pr_2-2-2_E_1200_5.jpg The FractInt compatible PAR file for the image is: pr_2-2-2_E { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150413_1515 passes=1 float=y center-mag=-6.323522903850758/0/1.68822378905018/1\ /0/0 params=0/6.16666666/0/0/0/0/0/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=78A6664434894BC5FI5JN6LR6PW7Ta7Wd7_j8co8fs9\ hv8dp8al7Yg6Ta6QY5MT4IN3FJ2BE26813411144776BA9GECM\ HEQKHVOK`QMdUPiYSo_UscZw`WqYUmVRgROaPMYLISIFMFDICA\ C87665222125727B29G2CM2DQ1GV1I`1Kd1Ni1Po1Rs0Tw0Rr0\ Pn1Nh1Kb1IZ2GU2DO2BK39E36834443176788BABGDFMEHQGKV\ JN`KQdMTiPWoQYsS_vPXpOVmMSgJPbINZGJUDGOCELABF78A66\ 64434894BC5FI5JN6LR6PW7Ta7Wd7_j8co8fs9hv8dp8al7Yg6\ Ta6QY5MT4IN3FJ2BE26813411144776BA9GECMHEQKHVOK`QMd\ UPiYSo_UscZw`WqYUmVRgROaPMYLISIFMFDICAC87665222125\ 727B29G2CM2DQ1GV1I`1Kd1Ni1Po1Rs0Tw0Rr0Pn1Nh1Kb1IZ2\ GU2DO2BK39E36834443176788BABGDFMEHQGKVJN`KQdMTiPWo\ QYsS_vPXpOVmMSgJPbINZGJUDGOCELABF78A4324895DG5JN6O\ V7Ta7Zh8co9iw8dp7Zh6Ta5NU4IN3CF26800044798FECMJGUO\ K`TOhYSobXw`WqWSiROaMJUIFMDBE87622025728F2CM1FU1I`\ 1Mh1Po3Oz0Rr0Nj1Kb1GV2DO29G368420767AAFDFMGJUJN`MS\ hPWoS`wPXpMTiJPbGKVDGOACH } frm:F_20150413_1515 { ; Similar to the parallel resistance formula z=0,c1=pixel-p1,c2=pixel+p1,c3=pixel: f1=z*z+c1, f2=z*z+c2, f3=z*z+c3, z=1/(1/f1+1/f2+1/f3), |z|<100 } -- Mike Frazier www.fracton.org

2 2

Re: [Fractint] pr_2-2-2_J; Fractint Evolver applied to Mike's pr_2-2-2_J
by Hal Lane 11 Apr '15

11 Apr '15

> pr_2-2-2_J_1200_5.jpg Very nice image and colors, Mike! When I applied Fractint's Evolver to your 3-term 'resistor' formula, I got this grid of thumbnail images: http://www.emarketingiseasy.com/MikeFrazier/M150409G.gif (Click my images for full size.) In the grid of images, P1 varies from -6.16666666 to +6.16666666 in both Real and Imaginary values in X and Y, respectively. The center thumbnail is P1 = (0, 0). Your Dropbox image with P1 = (0, 6.16666666) is the top center thumbnail. When I varied P1 from -8 to +8 in both real and imaginary values, I get this zoomed out grid of thumbnails: http://www.emarketingiseasy.com/MikeFrazier/M150409E.gif which shows a bit more of the parameter space. Here is an area in the parameter space I liked -- taken from near the 3rd thumbnail from the left -- on the X-axis, in the image: M150409E.gif above: http://www.emarketingiseasy.com/MikeFrazier/M150409K.jpg As simple as the formula is: z=0,c1=pixel-p1, c2=pixel+p1, c3=pixel: f1=z*z+c1, f2=z*z+c2, f3=z*z+c3, z=1/(1/f1+1/f2+1/f3), there's tremendous potential in this particular 3-term resistor formula and color map, Mike! Note: I used Richard's "Fractint for Windows beta 5", now called: "Iterated Dynamics," to calculate these images. - Hal Lane (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Mike Frazier Sent: Thursday, April 9, 2015 4:16 PM To: Fractint and General Fractals Discussion Subject: [Fractint] pr_2-2-2_J I released a new version of Fracton with a unified user interface and an improved color editor. The fractal I am posting today came from a search I started back in 2012. I was experimenting with a 3 term parallel resistor formula and I tried moving the terms along the imaginary axis instead of the real axis that I usually use. Moving the terms created a lot of interesting parent fractals but one alignment in particular stood out. The colors are from two color maps in Paul Lee's map collection. I used Fracton's new color editor to combine the maps and fit them to the fractal. I liked how the purple areas look like a meandering river. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/ the center thumbnail is P1 = (0, 0) -- not Mike's Dropbox image with P1 = (0, 6.16666666) The FractInt compatible PAR file for the image is: pr_2-2-2_J { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150409_1343 passes=1 float=y center-mag=-9.290328008454884/0/983.2889626222531/\ 1/0/0 params=0/6.16666666/0/0/0/0/0/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=22376BCAIHEQLIXQMdVQk_UsbYuYUmUQePMYKHQFDIA\ 9A65223327B2AI2DQ1HX1Kd1Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C\ 344000862HC5PI7XPAdWDlbGthIxjIrfHj`FcVCWPAOJ8GD587\ 300030681EC2MG2TK3`P4hT4pY5xW5tR4lN3eJ3YE2Q92I50A1\ 02630E81MD1VH1bM2jR2rW2z_2rW2jR1bN1WI1OE0G90840000\ 2864GC7OIAVOCbVFj`HrgKzmHrfFj`CcVAWO7OI4GC28622376\ BCAIHEQLIXQMdVQk_UsbYuYUmUQePMYKHQFDIA9A65223327B2\ AI2DQ1HX1Kd1Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C344000862HC5\ PI7XPAdWDlbGthIxjIrfHj`FcVCWPAOJ8GD587300030681EC2\ MG2TK3`P4hT4pY5xW5tR4lN3eJ3YE2Q92I50A102630E81MD1V\ H1bM2jR2rW2z_2rW2jR1bN1WI1OE0G908400002864GC7OIAVO\ CbVFj`HrgKzmHrfFj`CcVAWO7OI4GC28622376BCAIHEQLIXQM\ dVQk_UsbYuYUmUQePMYKHQFDIA9A65223327B2AI2DQ1HX1Kd1\ Nk1Rs0Tv0Pn1Mf1IZ2FS2BK38C344000862HC5PI7XPAdWDlbG\ thIxjIrfHj`FcVCWPAOJ8GD587300030681EC2MG2TK3`P4hT4\ pY5xW5tR4lN3eJ3YE2Q92I50A } frm:F_20150409_1343 { ; Similar to the parallel resistance formula z=0,c1=pixel-p1,c2=pixel+p1,c3=pixel: f1=z*z+c1, f2=z*z+c2, f3=z*z+c3, z=1/(1/f1+1/f2+1/f3), |z|<100 } -- Mike Frazier www.fracton.org _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

notification
by Niekamp 03 Apr '15

03 Apr '15

As announced I will be on a trip for some time, end open. If I return to the forum depends on what I will find - no internet or email for me till then. All dropbox links will be deleted by tomorrow. Albrecht

5 9

PCarson Fractalz
by JackOfTradeZ＠comcast.net 02 Apr '15

02 Apr '15

. Those are nice! Are the PAR files available? Good coloring - almost loox 32bit. .

2 1

Re: [Fractint] Fractint Digest, Vol 146, Issue 2
by JackOfTradeZ＠comcast.net 02 Apr '15

02 Apr '15

. Screw Drop-f'n-box! Why mess with it? I would be happy to post anyone's images on my server if you want - I sure got the space to. Lemme know. . ----- Original Message -----From: fractint-request(a)mailman.xmission.comTo: fractint(a)mailman.xmission.comSent: Wed, 01 Apr 2015 18:00:09 -0000 (UTC)Subject: Fractint Digest, Vol 146, Issue 2 Send Fractint mailing list submissions to fractint(a)mailman.xmission.com To subscribe or unsubscribe via the World Wide Web, visit https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractintor, via email, send a message with subject or body 'help' to fractint-request(a)mailman.xmission.com You can reach the person managing the list at fractint-owner(a)mailman.xmission.com When replying, please edit your Subject line so it is more specificthan "Re: Contents of Fractint digest..." Today's Topics: 1. Re: notification (david) 2. Re: notification (Niekamp) ---------------------------------------------------------------------- Message: 1Date: Tue, 31 Mar 2015 22:08:01 -1000From: david <gnome(a)hawaii.rr.com>To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com>Subject: Re: [Fractint] notificationMessage-ID: <551BA761.9090405(a)hawaii.rr.com>Content-Type: text/plain; charset=utf-8; format=flowed On 03/31/2015 09:38 PM, Niekamp wrote:> As announced I will be on a trip for> some time, end open.> If I return to the forum depends> on what I will find - no internet> or email for me till then.> All dropbox links will be deleted> by tomorrow.> Albrecht Ummm, why not just leave them there? You don't have to be around for Dropbox to serve them -- David W. Jonesgnome(a)hawaii.rr.comauthenticity, honesty, communityhttp://dancingtreefrog.com ------------------------------ Message: 2Date: Wed, 01 Apr 2015 18:48:10 +0200From: Niekamp <Niekamp(a)ish.de>To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com>Subject: Re: [Fractint] notificationMessage-ID: <551C214A.4060304(a)ish.de>Content-Type: text/plain; charset=windows-1252; format=flowed Am 01.04.2015 um 10:08 schrieb david:> On 03/31/2015 09:38 PM, Niekamp wrote:>> As announced I will be on a trip for>> some time, end open.>> If I return to the forum depends>> on what I will find - no internet>> or email for me till then.>> All dropbox links will be deleted>> by tomorrow.>> Albrecht>> Ummm, why not just leave them there? You don't have to be around for > Dropbox to serve them>I?m aware of that, but like I said, Dropbox has changed their attitude lately and I fear that theyinstall malware on updating like Avast and Avira. They do that even if you have a paid account.Allthough it?s a risk I?ll leave the links since march online and shut off updating.I?ll take a printed copy of my software with me and maybe - through dropbox - will addan update to the last link, Network Animal. using someone else?s computer.On my "to do" list is still one last item : finding a handle to apply the warp effect toJulia and Manowar, they are the only Julia Type frms used. Just watch the last link.Albrecht ------------------------------ Subject: Digest Footer _______________________________________________Fractint mailing listFractint@mailman.xmission.comhttps://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint ------------------------------ End of Fractint Digest, Vol 146, Issue 2****************************************

2 1

Random Colors
by Mike Frazier 01 Apr '15

01 Apr '15

Here is a fractal I made while working on Fracton's new color editor. The colors were made with the random sine color function. Random numbers were used for the start, amplitude, phase, and frequency of the sine waves. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/pr_3cossin-3_BCT_1200_5.j… The FractInt compatible PAR file for the image is: pr_3cossin-3_BCT { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150330_1758 passes=1 float=y center-mag=-0.3934968074876738/0/3795537747.33295/\ 1/0/0 params=1/1/0/3/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=000IgWFcTK`gOehShhXhhaggfdfj_doTbsM`vFYx9Vz\ 4Tz1Qz0Ny1Kw4It9FpFDlMChTBcZAZcAUgAQhAMhBIeDF`FDVH\ BOJBHMBBPD5SF1VI0XL0_P2aU7cZDecKghRglXhpbhtfgwhgyh\ ezfdzbazX_xQXvJVsDSo7Pk2Mf0Ja0HX2FT5DOBBKHAHPAEVAC\ `ABeBBhCChDDgFGcIJZKNTNRMQWFS`8Vd4Yi0`n0br1du4fw9g\ yFhzMhzThy_gwdfugeqhcnhaieZd`X`VUWORRHONALJ5JG1GD0\ EC0DB3BB7ACDAEKAHRAKYBObCTfEXhGahIffLkaNoXQsQTvJWx\ CZz6`z2bz0dy0fw2gt6hpBhlIhgPgcWfZadUecPh`LhZIgWFcT\ K`gOehShhXhhaggfdfj_doTbsM`vFYx9Vz4Tz1Qz0Ny1Kw4It9\ FpFDlMChTBcZAZcAUgAQhAMhBIeDF`FDVHBOJBHMBBPD5SF1VI\ 0XL0_P2aU7cZDecKghRglXhpbhtfgwhgyhezfdzbazX_xQXvJV\ sDSo7Pk2Mf0Ja0HX2FT5DOBBKHAHPAEVAC`ABgBBhCChEEeGHa\ JLWLPPOTIRYBUb6Xg2Zk0ap0cs2ev6fxCgzJhzQhzXhxagvffs\ hdphbkf`gbYbYVYRTTKQPDNL7KH3IE0FC0DB1CB5BBAADHAFOA\ IVAM`BQeDVhF_hHdgJidMm_PqTStMVwFXy9_z4az1cy0ex0gu4\ gr8hnFhjMgeTg`ZeWcdSgaNh_ } frm:F_20150330_1758 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2),d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(cos(z)-1)*sin(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

3 2

Netwaork Animal
by Niekamp 31 Mar '15

31 Mar '15

The first image of the new Manowar type. Maybe you´re impressed too. ; https://www.dropbox.com/sh/zqh7lrun5yco3k8/AACe6L-zumxTN3yCcDy6-6aka?dl=0 ; Including the frm again because of the new item. Inspite of that it has become shorter to save memory. ; Albrecht ; --------------------------Start Frm---------------------------------------- mfr_14_2 {; Albrecht Niekamp Mar.30,2015 Gen Update ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn4_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 px=trunc(da/100000) da=da-px*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 d=trunc(da/100) mow=(d==2)+(d==3) mv=(d==3)+(da==4) da=da-d*100 d=trunc(da/10) mag=d==2 d=trunc(da-d*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) If (1<px) d=(trunc(px/10))/9 if (fdm) da=fn4(px-100*d) else da=exp(px-100*d) endif d=px/73,37 px=d+sqr(-da) else px=p1 endif ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel mg=mg+(mg==0)*3 ;magnet x=mg else z=pixel ;lambdafn x=((1,0.4)*(|px|<=0)+px) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mv) ;manowar+Julia bb0=(4*(real(p1)<=0)+real(p1)*(0<p1) ) endif c=p1 z=pixel else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u x=x*u p=pp*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u x=x*u p=pp*u else z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else if (fdb) z=exp(z)*fn3(x) else z=exp(z)*sin(x) ;Lambdafn endif abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z2=z*z z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } --------------------------End Frm---Start Par------------------------------ Mano2-01 { ; Network Animal ; Time 0.00.54.37 ; Reso 1280/1024 ; Manowar Typ2 SG Miracle Map reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.479531/0.00308737/0.9693941/1/-25/1.31075705844807544e-014 params=-1.020105594042787/-0.1455732902005067/40000.32595700001/20000.05\ 06020602/152048.0404808025/24.160489403211/0.00482000595/256.1000003/512\ .1000003/768.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000<11>000000000<3>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zw\ m<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<\ 2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR\ 0C<3>A08004000<13>000 } ----------------------------End Par----------------------------------------

1 0

MFR_14 Basic Images - Additional Item
by Niekamp 31 Mar '15

31 Mar '15

I have added one more item to the Basic Images, a truly fascinating Manowar Typ2 image. It´s in the folder incl a small addon to the frm. Check the revised Input Table. ; https://www.dropbox.com/sh/6af1a8dluat6qfy/AABS-JPmz4oGd0UMAomhzURua?dl=0 ; Albrecht ; ---------------------------------Start Par-------------------------------- 4switch_Manow2_Bas { ; Alternative for Julia ; Time 0.01.45.08 ; 1280/1024 ; Manowar Typ2 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/sin passes=t center-mag=-0.479531/0.00308737/0.9693941/1/-25/1.31075705844807544e-014 params=-1.069911801507614/-0.3965514084292124/40000.32595750001/20000.05\ 06020602/152048.0404808025/384.160489402211/384.00482000595/256.1007683/\ 512.1007683001/512.1007683001 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000Ukp<2>7_d<3>7MS7JO7FL7CI<4>WCA`B9eB7<3>yA0<13>RA1PA1MA1<3>C92<\ 6>TXAV`BXcC<3>grI<3>TnXQm_MlcIkgEfp9az<3>OJoRFlVAiZ5fb0cd7_iFRnNIyb0yj00\ 00yr0yz1yzC<2>yzz<3>iqdeo_alU<3>Lb8<3>KQ8JM8JJ8<2>H88G44F00<3>SA5VD6YF7`\ I8dLAgMBhODiQF<3>peBqiAsm9uq8wu7yz5yz4yz3<4>yj4yg4yc4<3>yS5yP5yL6yI6yE6v\ E6sD6<6>uAIu9Ku9M<3>w7Sx7Ux6Wy6Yy5_<3>e5M`5IV4E<2>Z4H<3>O3DM2CJ2A<3>705F\ 0BN0G<3>f0Uk0Xp0`u0d<2>x0fy0gx0h<3>t1ms1nr1oq2q<2>u2u<3>b5eY6`T6X<2>E9L9\ AG6FO3KW0Qc0Sc<3>5Zc6`c6aa6c_6eY<3>EcgGciIbl<3>R_v<3>bivelvhnvkqvntvrww<\ 2>yzz<4>nvzgrw`ns } -----------------------------End-------------------------------------------

1 0

MFR_14 Basic Images
by Niekamp 30 Mar '15

30 Mar '15

In a few days I´ll be on a longer trip probably until end of may. Taking this as a reason to post some smaller and 2 bigger updates taking MFR_14 to it´s final state. Probably this is not the last one as I´m just a human beeing and produce errors. ; As some kind of reference there are 15 (!) images in the folder, 1 for each frm and it´s versions. The parfiles have been "cleaned" so they just contain inputs for the relevant image, but all bailout values that are very rarely changed, are there for easy switching, to accomodate the frm. Number 1 is the smallest bailout. Check the input table for quick reference. ; Now all frms can be edited for modification in 3 ways: Color compression, function or both. Inspite of the updates the frm has become smaller to completely avoid memory crashes. ; The warp effect update involves some incompatibilities, Julia Magnet and Lambda which could not be avoided, so keep a backup of earlier versions, just in case. ; The number or the pars equals the number of the participating frm and is also shown as title of an image - last example 56418-xx means manymods-phoenix-manowar- secant-magnet so the title shows the kind of the image. ; Including the pars and the frm in this post as I dont know how long Dropbox can be used, it has changed it´s attitude again from security to forced adware installing. Please copy the frm into your frm folder. ; https://www.dropbox.com/sh/6af1a8dluat6qfy/AABS-JPmz4oGd0UMAomhzURua?dl=0 ; Albrecht ; Any questions are welcome, of course. ; ------------------Start frm--------------------------------------------- mfr_14_2 {; Albrecht Niekamp Mar.29,2015 Gen Update ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn4_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 px=trunc(da/100000) da=da-px*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 d=trunc(da/100) mow=d==2 da=da-d*100 d=trunc(da/10) mag=d==2 d=trunc(da-d*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) If (1<px) d=(trunc(px/10))/9 if (fdm) da=fn4(px-100*d) else da=exp(px-100*d) endif d=px/73,37 px=d+sqr(-da) else px=p1 endif ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel mg=mg+(mg==0)*3 ;magnet x=mg else z=pixel ;lambdafn x=((1,0.4)*(|px|<=0)+px) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u x=x*u p=pp*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u x=x*u p=pp*u else z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u x=x*u p=pp*u else cb=p9 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else if (fdb) z=exp(z)*fn3(x) else z=exp(z)*sin(x) ;Lambdafn endif abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z2=z*z z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ---------------------------------------End Frm--Start Par----------------- 1_Secant_Basic { ; Time 02.33.90 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.512448/-4.44089e-016/0.6207443/1/-90/3.88578058618804789e-\ 016 params=0/0/10000.0703575002/10000.0506130602/150048.012810241/0.46048940\ 1111/0.00482000595/256.1000003/512.1000003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000IAH<12>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3\ >110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<38>\ 433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<35>JBI } 2_Mandel_Basic { ; Time 02.22.04 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=0.315433/0.00308737/0.9205382/1/-90/3.88578058618804789e-016 params=0/0/20000.3259575/10000.0506030602/150064.0128102411/0.4604894011\ 11/0.00482000595/256.1000003/512.1000003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0\ Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_\ 0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kk\ ammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<10>110 } 2switch_Dblmandel_Bas { ; Alternative for Single Mandel ; Time 0.01.57.81 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.49234/0.00308737/1.183773/0.9769/180 params=0/0/20000.32595760022/10000.0506030602/150064.0128102411/0.460489\ 401111/0.00482000595/256.1000003/512.1000003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0\ Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<\ 2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D3\ 6F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<10>\ 110 } 3_Bees_Basic { ; Time 0.00.33.90 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=1.52429/0.00308737/0.341731/1/-90/3.88578058618804789e-016 params=-0.05825983458967864/0.3785210730307932/30000.3259575/40000.05060\ 30602/150064.0128102411/0.460489401111/0.00482000595/256.1000003/512.100\ 0003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000747<3>323212111000VO2<15>970860650<3>110zh3<35>A70860750<3>110\ wON<3>_EDUCBO99<2>622DL6<2>351gy2<38>AF09E08D0<3>580570450<3>010LKXEDM76\ BSQO<38>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<47>848 } 4_Julia_Basic { ; Time 0.03.42.45 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.00582739/-0.0107726/1.04054/1.0215/97.665375882912187/-0.3\ 27264108497931305 params=1.058717612231818/-0.4155095065157018/40000.0703015/10000.0506130\ 033/150064.0128102411/0.46048940111111/0.6230639709148/256.1000003/512.1\ 000003/768.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=00y0000000000800A00000K00K0gK0g00hL0hK0jK00K00N00H0kH0k00kS0lU00Z\ 00_0la00d00d0000mh00j00000m0000n000n0000000or0xt0xu0uv0ux0sx0sx00x0<3>0y\ 00000y0<2>0y0zy0zy0zy00y00y0zxyzxvzx0ywu0vt0ut0qs0ps0pr00000000r0pq00q00\ q0000000oqz0000000p00qyo00p00pryqtyqwxqyxqy0qxwpvvpvuou0lttjstjq0hotbmsS\ XsQWsNVpJSpIG00000000F0G00DC0DB09A07606500500406400300000x00xv02vww00w0u\ wtuwtt2t02s0vs0vr01qr1q0uq00nq0nq0kqukn0il00j0hjt0it60r6gq50i00h00h00300\ f00S00F00F00E50D00C00C00700000060804805005000800860905900000068z08yp0yqo\ ysoxvoxvo9vo90ox8ow00w0000AtJnrJnpJmoJmnKkiKjfKkdK000000C00E00F00F0000<3\ >000wx0twxswwpvwnvu0uu0ttmtr0tq0spksp0rn0pmkokkojjljjkiij0ij000000000y00\ x00xzyxzxwyvw0tuxouxosvmsulqsj0qiophophm00l00k0hj<3>0hh0gh00f0fe0cd0cY00\ V00U00N00O000<6>000 } 4switch_Manowar_Bas { ; Alternative for Julia ; Time 01.45.08 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.479531/0.00308737/0.9693941/1/47.5000000000000071/-1.23373\ 533611470521e-014 params=-0.443968016602069/0.6559495834223456/40000.32595750001/20000.050\ 6020602/150064.0128102411/0.460489402211/0.00482000595/256.1000003/512.1\ 000003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000txxwyyyzz<3>pwznvzgrw<3>Fch7_d7Xa<3>7JO7FL7CI<3>RCCWCA`B9<3>tA\ 2yA0wA0<12>RA1PA1MA1<3>C92<6>TXAV`BXcC<3>grI<3>TnXQm_MlcIkgEfp9az<3>OJoR\ FlVAiZ5fb0cd7_iFRnNIyb0yj0000yr0yz1yzC<2>yzz<3>iqdeo_alU<3>Lb8<3>KQ8JM8J\ J8<2>H88G44F00<3>SA5VD6YF7`I8dLAgMBhODiQF<3>peBqiAsm9uq8wu7yz5yz4yz3<4>y\ j4yg4yc4<3>yS5yP5yL6yI6yE6vE6sD6<6>uAIu9Ku9M<3>w7Sx7Ux6Wy6Yy5_<3>e5M`5IV\ 4E<2>Z4H<3>O3DM2CJ2A<3>705F0BN0G<3>f0Uk0Xp0`u0d<2>x0fy0gx0h<3>t1ms1nr1oq\ 2q<2>u2u<3>b5eY6`T6X<2>E9L9AG6FO3KW0Qc0Sc<3>5Zc6`c6aa6c_6eY<3>EcgGciIbl<\ 3>R_v<5>hnvkqvntvrww } 5_Mmods_Sinus_Bas { ; Time 04.12.99 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=3.55271e-015/0/0.04266667 params=-0.05825983458967864/0.3785210730307932/50000.0859575/50000.05060\ 30602/150064.0128102411/0.4604894011111/0.00482000595/256.1000003/512.10\ 00003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=00y0hh0gh00f0fe0cd0cY00V00U00N00O000<4>000<2>0000800000800A00000K\ 00K0gK0g00hL0hK0jK00K00N00H0kH0k00kS0lU00Z00_0la00d00d0000mh00j00000m000\ 0n000n0000000or0xt0xu0uv0ux0sx0sx00x0<3>0y00000y0<2>0y0zy0zy0zy00y00y0zx\ yzxvzx0ywu0vt0ut0qs0ps0pr00000000r0pq00q00q0000000oqz0000000p00qyo00p00p\ ryqtyqwxqyxqy0qxwpvvpvuou0lttjstjq0hotbmsSXsQWsNVpJSpIG00000000F0G00DC0D\ B09A07606500500406400300000x00xv02vww00w0uwtuwtt2t02s0vs0vr01qr1q0uq00nq\ 0nq0kqukn0il00j0hjt0it60r6gq50i00h00h00300f00S00F00F00E50D00C00C00700000\ 060804805005000800860905900000068z08yp0yqoysoxvoxvo9vo90ox8ow00w0000AtJn\ rJnpJmoJmnKkiKjfKkdK000000C00E00F00F0000<3>000wx0twxswwpvwnvu0uu0ttmtr0t\ q0spksp0rn0pmkokkojjljjkiij0ij000000000y00x00xzyxzxwyvw0tuxouxosvmsulqsj\ 0qiophophm00l00k0hj<2>0hi } 5a_Mmods_Cosin_Bas { ; Time 0.09.59.57 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=0.332423/0.00308737/0.0511977/1/-90/3.88578058618804789e-016 params=-0.05825983458967864/0.3785210730307932/50000.0759575/50000.05060\ 30602/150064.0128102411/0.460489401111/0.00482000595/256.1000003/512.100\ 0003/512.1000003 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6\ >Z0EV0DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH\ 0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kkammcpoe<3>zwm<3\ >mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>1100001101101\ 10 } 6_Phoenix_Basic { ; Time 00.03.20.10 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=0.0530235/-0.0039903/0.9981015/1/-90/-1.23373533611470521e-01\ 4 params=0.7046723838007751/0.3785210730307932/60000.07005750001/50000.050\ 6030602/150064.0128102411/0.460489401111/0.00482000595/256.1000003/512.1\ 000003/768.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0\ Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<\ 2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D3\ 6F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<10>\ 220 } 6a_PhoenSym_Basic { ; Time 00.06.28.11 ; 1280/1024 ; Symmetrical Phoenix Version ; Real(P1) only reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=0.0530235/-0.0039903/0.9981015/1/-90/-1.23373533611470521e-01\ 4 params=0.2665486617633596/0/60000.0700575/50000.0506030602/150064.012810\ 2411/0.460489401111/0.00482000595/256.1000003/512.1000003/768.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0\ Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_\ 0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kk\ ammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<10>220 } 7_Newton_Basic { ; Time 00.02.48.18 ; 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.000670243/0.00308737/0.7444028/1/-90/3.88578058618804789e-\ 016 params=-0.05825983458967864/0.3785210730307932/70000.3259575/30000.05060\ 30602/150048.012810241/0.460489401111/0.00482000595/256.1000003/512.1000\ 003/768.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3\ >z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<\ 2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kkammcpoe<3\ >zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<4>000 } 8_lambda_Basic1 { ; Time 0.01.46.33 ; 1280/1024 ; Version1 - Virtual p1 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/exp passes=t center-mag=0.174371/-1.18282/4.345257/1/-90/3.88578058618804789e-016 params=-0.00805688650166326/0.04943998535111546/80000.32598749999/20000.\ 0506030602/150064.0128102411/0.460489401141/0.00482000595/256.1000003/51\ 2.1000003/512.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000pnX<6>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A0800400\ 0<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7\ UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3\ >VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOj\ gRmjT<3>zzcwvasrZ } 8a_lambda_Basic2 { ; Time 0.08.09.39 ; 1280/1024 ; Version2_P1-seed reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=0.174371/-1.18282/4.345257/1/-90/3.88578058618804789e-016 params=0.6598864711447493/-0.9096194341868342/80000.32590149999/20000.05\ 06030602/150048.0128102411/0.460489401111/0.00482000595/256.1000003/512.\ 1000003/512.1000003 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000pnX<6>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A0800400\ 0<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2\ oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE\ 4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>z\ zcwvasrZ } 8switch_Magnet_Basic1 { ; Alternative for Lambda ; Time 02.16.98 ; 1280/1024 ; Version1 - Variabel reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=cotanh/exp/exp/sin passes=t center-mag=-0.300855/-0.00563554/0.6131608/1/-90/3.88578058618804789e-01\ 6 params=-0.05825983458967864/0.3785210730307932/80000.6459575/14235.49110\ 30602/152048.0404808041/0.160489401211/384.00482000595/256.1007683001/51\ 2.1007683001/768.1007683001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9\ >f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf\ 0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G5\ 4D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<\ 7>220 } 8switch_Magnet_Basic2 { ; Alternative for Lambda ; Time 02.16.98 ; 1280/1024 ; Version2 - P1 seed reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.300855/-0.00563554/0.6131608/1/-90/3.88578058618804789e-01\ 6 params=3.117115721943445/0/80000.6459575/14235.4911030602/152048.0404808\ 001/0.160489401211/384.00482000595/256.1007683001/512.1007683001/768.100\ 7683001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000987<7>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<4\ 9>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3>110wON<3>_EDUC\ BO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<29>998 } -------------------------------------End Par--------------------------------

1 0

Big Mama Atlantis
by Niekamp 28 Mar '15

28 Mar '15

"Big Mama Atlantis" ; The Holy Grail has turned into a ghost and is even more adorable. Our last stop of course. ; Maybe you liked the trip and didn´t take the the comments too seriously. It´s just a new kind of game to be plaid with Big Mama of all fractal programs. ; https://www.dropbox.com/sh/dur503zom39c3op/AADGNCexo7bMJsdCrDUgLbzka?dl=0 ; Albrecht ; -------------------------------Start Par----------------------------------- 56418-82 { ; Big Mama Atlantis ; Time 0.04.04.58 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=conj/atan/asinh/cotanh passes=t center-mag=+0.00000005956872296/+0.00010616713532360/75250.12 params=1.926337473677786/0.5196722312082278/56418.06595706656/51243.4911\ 030602/150048.0128102441/1212.460489402211/384.00482000595/128.200128300\ 1/256.2000543001/512.1000123001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000mhZ<3>`UKYQGVMC<2>KA0000<43>000<4>000330<6>220220220<3>1100001\ 10<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV\ 0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>\ K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>z\ wm<2>plb } --------------------------------------End----------------------------------

1 0

Atlantis Flight Control
by Niekamp 27 Mar '15

27 Mar '15

"Atlantis Flight Control" ; Even a visit to the flight control belongs to our schedule. Just in case you dont know: The island has risen from the sea and now travels through space. ; https://www.dropbox.com/sh/dur503zom39c3op/AADGNCexo7bMJsdCrDUgLbzka?dl=0 ; Albrecht ; --------------------------------Start Par-------------------------------- 56418-65 { ; Atlantis Flight Control ; Time 0.25.38.63 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=conj/atan/asinh/cotanh passes=t center-mag=0.00659043/0.897882/3.438807/0.5508/-1/5.53109483267233237 params=1.926337473677786/0.5196722312082278/56418.06595706656/51243.4911\ 030602/150048.0128102441/1212.460489402211/384.00482000595/128.200128300\ 1/256.2000543001/512.1000123001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000mjU<3>`WKXSIUOF<3>H85000A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A0\ 8004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE\ 1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjd\ VfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<\ 7>gcOjgRmjT<3>zzc<2>pnX } ---------------------------------End----------------------------------------

1 0

Atlantis Research Centre
by Niekamp 26 Mar '15

26 Mar '15

"Atlantis Research Centre" ; It´s a pity that all results are lost. Our third stop of the Atlantis Tour. All stops are deep views into the parent. ; https://www.dropbox.com/sh/dur503zom39c3op/AADGNCexo7bMJsdCrDUgLbzka?dl=0 ; Albrecht ; --------------------------------Start Par---------------------------------- 56418-30 { ; Atlantis Research Centre ; Time 0.00.49.44 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/sin passes=t center-mag=-9.11493e-013/9724.14/0.7246377 params=-0.9899594103823969/0.4572283089693899/56418.06595700001/14235.49\ 11030602/152048.0404808025/384.1604894022/384.00482000595/128.1007683001\ /256.1007683001/512.1007683001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000222<2>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<49>636535424<\ 3>000VO2<15>970860650<3>110zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>622DL\ 6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<40>322 } ----------------------------------End--------------------------------------

1 0

Atlantis Gardens
by Niekamp 25 Mar '15

25 Mar '15

"Atlantis Gardens" ; This is the second stop of our sightseeing tour. It´s recreative and relaxing to spend a day in such a beautiful enironment. ; https://www.dropbox.com/sh/dur503zom39c3op/AADGNCexo7bMJsdCrDUgLbzka?dl=0 ; Albrecht ; -----------------------------Start Par----------------------------------- 56418-15 { ; Atlantis Gardens ; Time 0.04.34.46 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/sin passes=t center-mag=+0.29762668007963770/-0.01318929490009096/4848.414/1/107.9999\ 99999993562/6.84494128044832451e-012 params=-0.9899594103823969/0.4572283089693899/56418.06595750001/51243.49\ 11030602/152048.0404808025/384.1604894022/384.00482000595/128.1007683001\ /256.1007683001/512.1007683001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000ICF<3>aB9fB7kB6<2>zA0<13>SA1QA1NA1<3>D92<6>UXAW`BYcC<3>hrI<3>U\ nXRm_NlcJkgFfpAaz<3>PJoSFlWAi_5fc0ce7_jFRoNIzb0zj0000zr0zz1zzC<2>zzz<3>j\ qdfo_blU<3>Mb8<3>LQ8KM8KJ8<2>I88H44G00<3>TA5WD6ZF7aI8eLAhMBiODjQF<3>qeBr\ iAtm9vq8xu7zz5zz4zz3<4>zj4zg4zc4<3>zS5zP5zL6zI6zE6wE6tD6<6>vAIv9Kv9M<3>x\ 7Sy7Uy6Wz6Yz5_<3>f5Ma5IW4E<2>_4H<3>P3DN2CK2A<3>805G0BO0G<3>g0Ul0Xq0`v0d<\ 2>y0fz0gy0h<3>u1mt1ns1or2q<2>v2u<3>c5eZ6`U6X<2>F9LAAG7FO4KW0Qc<3>5Xc6Zc7\ `c7aa7c_7eY<3>FcgHciJbl<3>S_v<3>civflvinvlqvotvsww<2>zzz<3>rwzovzhsw<3>G\ ch8_d8Xa<5>8CIDCH } ------------------------------End------------------------------------------

1 0

Exploding Colors
by Niekamp 24 Mar '15

24 Mar '15

Every programmer knows: You must never state that the software is finalized - that´s the safest way to face bugs afterwards. Jonathan, if he is reading will confirm rhis is a fact. Yesterday, half an hour after doing so - BOING! memory crash. It needed some hours meditating - the best time is early in the morning still in bed - to find a solution. A block of code including some variables and speedups of the mainloop could be replaced by more effective code, so no more memory problems (hopefully). The image of yesterday´s type, "exploded colors" is extra special as it covers the complete spectrum of any SG map, so colorcycling only produces some kind of flicker. The difference of the otherwise - in this context - similar maps is a different order and organization. In the folder you find some variations of this iomage. Including the frm again for easy saving. ; https://www.dropbox.com/sh/vdey32zqf8pb3eh/AAAvQgRVpl-hunO0jcuxvf5Ja?dl=0 ; Albrecht ; -----------------------------------Start Par----------------------------- Lambd-13 { ; Exploded Colors III ; LambdaFN - Solo ; Time 0.15.08.97 Reso 1280/1024 ; Memory Crash Update reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=exp/exp/sqrt/sin passes=t center-mag=2.22045e-016/-1.04895/0.7183908/1/22.4999999999999964/3.88578\ 058618804789e-016 params=0.2472764976958525/-0.04074480422376174/80000.32590150023/20000.0\ 506030602/150148.0092759982/384.160489401131/384.00482000595/256.1007683\ /512.1007683001/512.1007683001 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000zr0zz1zzC<2>zzz<3>jqdfo_blU<3>Mb8<3>LQ8KM8KJ8<2>I88H44G00<3>TA\ 5WD6ZF7aI8eLAhMBiODjQF<3>qeBriAtm9vq8xu7zz5zz4zz3<4>zj4zg4zc4<3>zS5zP5zL\ 6zI6zE6wE6tD6<6>vAIv9Kv9M<3>x7Sy7Uy6Wz6Yz5_<3>f5Ma5IW4E<2>_4H<3>P3DN2CK2\ A<3>805G0BO0G<3>g0Ul0Xq0`v0d<2>y0fz0gy0h<3>u1mt1ns1or2q<2>v2u<3>c5eZ6`U6\ X<2>F9LAAG7FO4KW0Qc<3>5Xc6Zc7`c7aa7c_7eY<3>FcgHciJbl<3>S_v<3>civflvinvlq\ votvsww<2>zzz<3>rwzovzhsw<3>Gch8_d8Xa<3>8JP8FL8CI<4>XCAaB9fB7<3>zA0<13>S\ A1QA1NA1<3>D92<6>UXAW`BYcC<3>hrI<3>UnXQm`NlcJkgFfpAaz<3>PKoSFlWAi_5fc0ce\ 7_jFRoNIzb0zj0000 } frm:mfr_14_2 {; Albrecht Niekamp Mar.23,2015 Memory crash upd ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn4_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 px=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<px) d=(trunc(px/10))/9 if (fdm) da=fn4(px-100*d) else da=exp(px-100*d) endif d=px/73,37 px=d+sqr(-da) else px=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 d=trunc(da/100) mow=d==2 da=da-d*100 d=trunc(da/10) mag=d==2 d=trunc(da-d*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) if (mag>mg) mg=real(p1) endif ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|px|<=0)+px) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px*u p=pp*u x=x*u else c=px z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px*u p=pp*u x=x*u else cb=p9 c=px z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px*u p=pp*u x=x*u else cb=p9 c=px z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px*u p=pp*u x=x*u else cb=p9 c=px z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else if (fdb) z=exp(z)*fn3(x) else z=exp(z)*sin(x) ;Lambdafn endif abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ---------------------------------------End---------------------------------

2 1

Atlantis
by Niekamp 24 Mar '15

24 Mar '15

*Early Morning in Atlantis* ; This is a peaceful one with lots of athmosphere. ; Albrecht ; https://www.dropbox.com/sh/dur503zom39c3op/AADGNCexo7bMJsdCrDUgLbzka?dl=0 ; ---------------------------------Start Par-------------------------------- 56418-07 { ; ManyMods_phoenix_manowar_secant_magnet ; Early Morning in Atlantis ; Time 0.03.52.99 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/sin passes=t center-mag=1.77636e-015/4.2197/3.253333/1/180 params=-0.9899594103823969/0.4572283089693899/56418.06595700001/14235.49\ 11030602/152048.0404808025/384.1604894022/384.00482000595/128.1007683001\ /256.1007683001/512.1007683001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000P7TK8PF9LAAG<2>0Qc<3>5Xc6Zc7`c7aa7c_7eY<3>FcgHciJbl<3>S_v<3>ci\ vflvinvlqvotvsww<2>zzz<3>rwzovzhsw<3>Gch8_d8Xa<3>8JP8FL8CI<3>SCCXCAaB9<3\ >uA2zA0xA0<12>SA1QA1NA1<3>D92<6>UXAW`BYcC<3>hrI<3>UnXRm_NlcJkgFfpAaz<3>P\ JoSFlWAi_5fc0ce7_jFRoNIzb0zj0000zr0zz1zzC<2>zzz<3>jqdfo_blU<3>Mb8<3>LQ8K\ M8KJ8<2>I88H44G00<3>TA5WD6ZF7aI8eLAhMBiODjQF<3>qeBriAtm9vq8xu7zz5zz4zz3<\ 4>zj4zg4zc4<3>zS5zP5zL6zI6zE6wE6tD6<6>vAIv9Kv9M<3>x7Sy7Uy6Wz6Yz5_<3>f5Ma\ 5IW4E<2>_4H<3>P3DN2CK2A<3>805G0BO0G<3>g0Ul0Xq0`v0d<2>y0fz0gy0h<3>u1mt1ns\ 1or2q<2>v2u<5>U6X } ---------------------------------End---------------------------------------

1 0

More on DOSBOX+FRACTINT Program
by Knute Myhrvold 24 Mar '15

24 Mar '15

Some fine-tuning you can do if you wish with Dosbox+Fractint: If you are in FULLSCREEN and want to change to a smaller window -- Press "Alt+Enter" which will change it to a Window, probably too large. So then in the Dosbox menu at the top-left click "Video>Resolution>Window" and click "Original"... then in Fractint set your resolution (Mode) to the window size you want. Then after working with your fractal in the lower, faster mode you can change it back to SF10, or even higher modes with more than 256 colors (32k, 64k or even 16m colors, at least in smaller windows like 800x600, and if your adapter can handle them). The second fine-tune you can do if you want a BEEP when Fractint finishes do this: In your DOSBox Folder find "dosbox.conf" and open it as text. Make the following 2 changes: Scroll down about 1/3 to " nosound=true" and change it to nosound=false and Scroll down about 2/3 to "pcspeaker=false" and change it to pcspeaker=true The result will not be the old beeps from your PC speaker, but one sound, like a "tap" from your desktop speakers when Fractint finishes its final pass. ******************************* I have been corresponding with kolano, the author, and he gave me the abovementioned tips. He also says he is working on an update to the program. ****************************** I am still very happy that I've finally been able to use Fractint and in many modes. But yes, I think it's slow... yet "slow" is better than nothing. I am no programmer so I wish that hoffentlich someone like you Niekamp, could work with kolano to improve his program. Slow is better than nothing aber schnell ist ja besser! --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

A New Star
by Niekamp 24 Mar '15

24 Mar '15

Yesterday´s image was only some kind of a demo. Now here´s the first "real" one, maybe you´ll like it. ; https://www.dropbox.com/sh/9j90xwqicomrjrm/AADELPOEArYva-16yuq0PdITa?dl=0 ; Albrecht ; -----------------------------Start Par----------------------------------- 10008-01 { ; A New Star ; Time 0.03.14.11 Reso 1280x1024 ; Secant - Lambda ; First Lambda Mix reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/exp/exp/exp passes=t center-mag=0.00472926/0.373204/0.1110818/1/-90/3.88578058618804789e-016 params=0.7947172460097048/-0.5354319895016327/10008.32130150001/25234.05\ 06030602/152048.0094808048/384.160489401141/384.00482000595/256.1007683/\ 512.1007683001/512.1000003001 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3\ >z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_\ 0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kk\ ammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<\ 3>110000110 } -------------------------------End------------------------------------------

12 14

Re: [Fractint] A Happy New Discovery
by Hal Lane 24 Mar '15

24 Mar '15

--------- schrieb Albrecht: ------------------------- > Todays image [calculated with "kolano" of DOSBOX+FRACTINT] needs > almost an hour, 1280/1024, > compared to 9 min with XP dos and > 3 min with a bootstick [running 'native' DOS running directly on the > 'bare' machine.] Thanks for those calculation time comparisons, Albrecht! Am I correct in assuming that the "XP dos" above is the DOS provided within/installed with WinXP? <===<< Also, what was the "Idle sensitivity" setting of your Fractint 'shortcut's Properties when you calculated the image with WinXP DOS? <===<< Right click: Fractint.exe's 'shortcut' > Properties > Misc tab > Idle sensitivity I have two Fractint.exe 'shortcuts': One has "Idle sensitivity" set to "Low" to get DOS Fractint to use 100% of the WinXP CPU; The other has "Idle sensitivity" "High" to get DOS Fractint to use ~50% of the WinXP CPU. What was Fractint.exe's "Idle sensitivity" when it took 9 min to calc. your image in WinXP DOS? <===< Note: The 'shortcuts' I'm referring to above are the ones that are automatically generated the first time that a DOS program is run. I think that these used to be called .PIF files -- Program Information Files(?) - Hal Lane (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## -----Original Message----- From: Fractint [mailto:fractint-bounces@mailman.xmission.com] On Behalf Of Niekamp Sent: Monday, March 23, 2015 6:16 PM To: Fractint and General Fractals Discussion Subject: Re: [Fractint] A Happy New Discovery Am 23.03.2015 um 19:50 schrieb Knute Myhrvold: > I am running it on my PC on WindowsXP and it runs perfectly, full-screen, in SF10 or any of the video modes I've tried so far. Thank You from me too. Now I can run hundreds of 1600/1200 images again although the Nvidia card does not support it as it is not available from my 1900/1080 flatscreen TV. Fullscreen! The speed is not so good, but maybe improved using the config file. Todays image needs almost an hour, 1280/1024, compared to 9 min with XP dos and 3 min with a bootstick, which is still the simplest and fastest solution. Albrecht _______________________________________________ Fractint mailing list Fractint(a)mailman.xmission.com https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

A Happy New Discovery
by Knute Myhrvold 23 Mar '15

23 Mar '15

For those of you who, like me, have been struggling trying to get DOS FractInt to work I have found what I believe is THE solution: The special make by "kolano" of DOSBOX+FRACTINT downloadable here: http://eyecandy.gnugget.net/Fractint/ I am running it on my PC on WindowsXP and it runs perfectly, full-screen, in SF10 or any of the video modes I've tried so far. DOSBOX is an "emulator"... it is a Program which will run in Windows like any other Program and it does not harm or disturb your Windows OS. Earlier, I had installed Dosbox and then installed FractintDOS into it, and Fractint ran well. But this special make by kolano of Dosbox+Fractint(included) is much better. During the past couple months I think I've tried everything else to get Fractint to run properly: I installed VirtualBox and then VMware, both with FreeDOS and Windows98 installed as their Guests, and then with Fractint installed into these Guests. In all these instances Fractint could be made to "work", at least feebly, but never properly. I've also tried to install other versions of DOS (like MS DOS 7.1 - what's in Win9x) virtually, but without success. I also got an old PC (Dell Optiplex 740) with the intention of installing Windows98 as its main OS... but learned that is impossible because the hardware in that PC is "too modern" (not IDE), and Win9x can't see SATA and can't use NTFS. I even repartitioned/reformatted half the drive in that old Optiplex to FAT32 but that didn't help, either. So you can understand why I'm enthused about this DOSBOX+FRACTINT! --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

3 2

Re: [Fractint] I am Curious....
by Jason Hine 23 Mar '15

23 Mar '15

I have a Facebook account, but I check it only sporadically and post there rarely. - Jason H

1 0

Curious - Out of the Box
by Niekamp 22 Mar '15

22 Mar '15

Re facebook, I´m sharing Jack´s and David´s attitude. Don´t even have a smartphone, and never will, am security minded and like my privacy. And I hate being interrupted when I´m diving into creativity. About my images: Am a bit tired of all those clean and symmetrical pictures and think it´s time for a temporary (?) change. MFR can do anything you want and the Lambda frm is suitable for new "adventures". You just choose a basic function, let the evolution mode find something interesting. Every function has characteristical details. Then find a zoom and the colors. Finally the complexity can be chosen by increasing or decreasing the bailout. Voila! That´s how today´s image came about and I left it unchanged as I think it´s interesting enough. Your opinion? I like Tony´s expression and used it as a title. ; https://www.dropbox.com/sh/yk9l9k0hkfwod7t/AAAqWC46Qb9PQvzfF5UxDvSJa?dl=0 ; Albrecht ; ------------------------------------Start Par---------------------------- Lambd_04 { ; Out of the Box ; Lambda - Sqrt Function ; Time 0.10.37.96 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=exp/exp/sqrt/sin passes=t center-mag=0/0/0.6666667 params=0.2481521042512283/-0.04168218024231699/80000.32590150023/20000.0\ 506030602/150148.0084759982/384.160489401131/384.00482000595/256.1007683\ /512.1007683001/512.1007683001 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 colors=000zr0zz1zzC<2>zzz<3>jqdfo_blU<3>Mb8<3>LQ8KM8KJ8<2>I88H44G00<3>TA\ 5WD6ZF7aI8eLAhMBiODjQF<3>qeBriAtm9vq8xu7zz5zz4zz3<4>zj4zg4zc4<3>zS5zP5zL\ 6zI6zE6wE6tD6<6>vAIv9Kv9M<3>x7Sy7Uy6Wz6Yz5_<3>f5Ma5IW4E<2>_4H<3>P3DN2CK2\ A<3>805G0BO0G<3>g0Ul0Xq0`v0d<2>y0fz0gy0h<3>u1mt1ns1or2q<2>v2u<3>c5eZ6`U6\ X<2>F9LAAG7FO4KW0Qc<3>5Xc6Zc7`c7aa7c_7eY<3>FcgHciJbl<3>S_v<3>civflvinvlq\ votvsww<2>zzz<3>rwzovzhsw<3>Gch8_d8Xa<3>8JP8FL8CI<3>SCCXCAaB9<3>uA2zA0xA\ 0<12>SA1QA1NA1<3>D92<6>UXAW`BYcC<3>hrI<3>UnXQm`NlcJkgFfpAaz<3>PKoSFlWAi_\ 5fc0ce7_jFRoNIzb0zj0000 } -----------------------------------------End-------------------------------

1 0

FaceBook
by JackOfTradeZ＠comcast.net 22 Mar '15

22 Mar '15

. Barry Smith expressed my sentiments exactly; as much as I am a techie, I never bothered with FB or TWIT; I don't even have a smart phone! I am more concerned with privacy and security, and I dont need a lot of nonsense chatter in my life. However, other people with my name have these accounts and as I am a professional I need to keep my online profile "clean". [ BTW, any of you ever google yourself? may be surprised! ] SO I got myself on FB and twit last year just to fill in the blank and keep it clean. I do play with FB on occasion, but I dont bother tweeting the world every move I make or thing I do. https://www.facebook.com/lloyd.garrick.3 .

1 0

Re: [Fractint] I am Curious....
by David Jones 22 Mar '15

22 Mar '15

I don't do Facebook; it's the Russian Mafia's single most successful money-laundering operation. I am on Twitter, though. David W. Jones gnome(a)hawaii.rr.com authenticity, honesty, community http://dancingtreefrog.com On Mar 21, 2015 9:16 PM, Barry Smith <barrys(a)grapevine.net.au> wrote: > > Interesting question, Paul > > I have been using computers since 1958, and using e-mail (initially on > bulletin boards) and also using the Internet about ten years before the > WWW or browsers appeared. > > But I have NEVER felt the need to use Facebook or Twitter: ordinary > e-mail and the web meet all my needs. > > In addition I have NEVER owned or wanted a mobile phone, let alone a > smart phone. As I have been legally blind for about six years, I don't > like hand-held devices. > > I think PNL has got us off topic. > > Cheers, > > Paul N. Lee wrote: > > > > How many people in this Mailing List are on Facebook ?? > > > > And for the record, this is my Facebook location: > > https://www.Facebook.com/Nahee.Enterprises > > > > > > Sincerely, > > P.N.L. > > > > _______________________________________________ > > Fractint mailing list > > Fractint(a)mailman.xmission.com > > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint > > > Barry W Smith > > 16/21 Wiseman Street Macquarie ACT 2614, Australia > > Tel. +61 2 6251 2119 > > e-mail: barrys(a)grapevine.net.au > > _______________________________________________ > Fractint mailing list > Fractint(a)mailman.xmission.com > https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint

1 0

Colors in XS
by Niekamp 22 Mar '15

22 Mar '15

Don´t Know if you´ll like this one but definetely it´s interesting and once again a new type. Managed to preserve the full Lambda functionality with this update inspie of default functions and just a minimum of additional code. Including the frm version - down compatible as always - in the par. Jack can you generate the latest images again to be sure they are correct amd no memory problems turn up? Thank you! Jonathan please update your data base, dont think any more updates will be necessary. ; https://www.dropbox.com/sh/0p2s2jzv5d40k3o/AADxQN1x0-O3tGNjFcS967qaa?dl=0 ; Albrecht ; --------------------------start par-------------------------------------- Lambd_22 { ; Colors in XS ; LambdaFn Solo ; Time 0.18.53.83 Reso 1280/1024 ; Full Lambda functionality with default functions reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=exp/exp/exp/sin passes=t center-mag=0.46742/-0.273285/1.724763/1/-105.000000000000028/-2.50563458\ 870090017e-014 params=0.2615497299111911/-0.8593951231421858/80000.32590150023/25234.05\ 06030602/150148.0404808048/384.160489401131/384.00482000595/256.1007683/\ 512.1007683001/512.1007683001 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000H29<2>805G0BO0G<3>g0Ul0Xq0`v0d<2>y0fz0gy0h<3>u1mt1ns1or2q<2>v2\ u<3>c5eZ6`U6X<2>F9LAAG7FO4KW0Qc<3>5Xc6Zc7`c7aa7c_7eY<3>FcgHciJbl<3>S_v<3\ >civflvinvlqvotvsww<2>zzz<3>rwzovzhsw<3>Gch8_d8Xa<3>8JP8FL8CI<3>SCCXCAaB\ 9<3>uA2zA0xA0<12>SA1QA1NA1<3>D92<6>UXAW`BYcC<3>hrI<3>UnXQm`NlcJkgFfpAaz<\ 3>PKoSFlWAi_5fc0ce7_jFRoNIzb0zj0000zr0zz1zzC<2>zzz<3>jqdfo_blU<3>Mb8<3>L\ Q8KM8KJ8<2>I88H44G00<3>TA5WD6ZF7aI8eLAhMBiODjQF<3>qeBriAtm9vq8xu7zz5zz4z\ z3<4>zj4zg4zc4<3>zS5zP5zL6zI6zE6wE6tD6<6>vAIv9Kv9M<3>x7Sy7Uy6Wz6Yz5_<3>f\ 5Ma5IW4E<2>_4H<5>K2A } frm:mfr_14_2 {; Albrecht Niekamp Mar.21,2015 Lambda fn-upd ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn4_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 if (fdm) da=fn4(sp-100*d) else da=exp(sp-100*d) endif d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 d=trunc(da/100) mow=d==2 da=da-d*100 d=trunc(da/10) mag=d==2 d=trunc(da-d*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else if (fdb) z=exp(z)*fn3(x) else z=exp(z)*sin(x) ;Lambdafn endif abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ---------------------------end par-------------------------------------

1 0

Complexity
by Niekamp 20 Mar '15

20 Mar '15

Needed some days for a bugfix concerning the generation of Lambda images. Due to complexity of the latest version it can be a difficult task, Jonathan mentioned the same problem - on his level - which is skyhigh compared to mine. Anyway the generation of my own definition of a complex number to replace P1 works satisfactory and even has the possibility to increase it´s versions with a choosable function. Of course the image is called "complexity". ; https://www.dropbox.com/sh/aajz1puopwj10fc/AAA6hkyG9N1cNQeC_8RMRewja?dl=0 ; Albrecht ; ----------------------------------Start Par----------------------------- Lambd-01a { ; Complexity ; Lambda Variable set to 23 ; Time 0.01.53.42 Reso 1280/1024 ; New complex number definition reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/exp/sin/conj passes=t center-mag=+0.42201922872088370/-1.08606971938494700/55.44183/1/-90/-1.2\ 3373533611470521e-014 params=0.2809320352793969/-0.8534775841547899/80000.32592350002/11111.05\ 06030602/150848.0404808048/1111.160489401141/1111.00482000595/256.111111\ 00001/512.1111110000101/512.1111110000101 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000D01<8>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q\ 0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>\ 2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<4\ 3>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFR\ KDOGALC8H85E43A00 } ----------------------------End--------------------------------------------

1 0

Power and Protection
by Niekamp 18 Mar '15

18 Mar '15

Had a good conversation with my friend Hal, who with his superior knowledge of human behavior made it clear to me that I have to learn ignoring the attacks of an "internet troll" who shoots from a safe distance. This person, driven by an inferiority complex, likes to make others feel bad to reassue himself of his superiority. As this definetely is not my problem I´ll try to concentrate on creativity and the positive emotions connected to it. Enough of that. Jonathan is working on the memory problem, good to know, and advised to go on using patch 12 until it´s solved. So here is my new "visual experience", one of the kind that does not resemble anything you´ve seen before, but makes you look twice. ; https://www.dropbox.com/sh/rezhlesikbqjf6x/AACH0CfJ8ZdgtjezVXaYJogDa?dl=0 ; Albrecht ; ------------------------------Start Par---------------------------------- 80484-01 { ; Power and Protection ; Magnet-Manowar ; Time 0.01.52.43 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/sin/exp/sin passes=t center-mag=-1.13217/5.55112e-016/1.718213/1/90/3.88578058618804789e-016 params=1.892178106021302/0.4900357066560869/80484.32595752121/25232.0506\ 020602/152048.0404808035/384.1604894022/384.00482000595/256.1007683/512.\ 1007683001/512.1007683001 float=y maxiter=3072 inside=maxiter outside=tdis periodicity=0 rseed=-2436 sound=off colors=000usixukzwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>2202\ 20220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl\ 0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w\ <4>_0eX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<1\ 6>kkammcpoesqg } -----------------------------------End------------------------------------

1 0

FOTD 16-03-15 (Fractals-101 [A-6,M-6])
by Jim Muth 16 Mar '15

16 Mar '15

FOTD -- March 16, 2015 (Rating A-6,M-6) Fractal visionaries and enthusiasts: I have been pretty silent lately but I am certainly still here. Though today's image is nothing new, it shows that between my more artistic efforts I still find time to check into the world of fractals. And don't give up hope. Some of my latest efforts should soon be worth posting on the web sites. If the Mandelbrot set is the mother of all Z^2+C fractals, then the Julibrot is the grandmother, for it is the four-dimensional superfractal that contains the Mandelbrot set as a single two-dimensional slice. Today's image shows an undistorted view of a different slice of this Julibrot, sliced in a totally new orientation, with the vertical direction the imaginary C axis and the horizontal direction the real Z axis. I call this orientation the Oblate direction, though this is totally unofficial. The image slices through the M-set at the point -0.8 on the real C axis, just beyond Seahorse Valley. I have named the image "Fractals-101" because the 4-D aspect is basic to so many fractals. I could rate it no higher than a double 6 however because we have been here so often before. The calculation time is almost instant however, and this is the image's best point. The finished image is posted at: <http://www.crosscanpuzzles.com/Archives.html> <http://www.emarketingiseasy.com/TESTS/FOTD/jim_muths_fotd.html> <http://www.Nahee.com/FOTD/> <http://user.xmission.com/~legalize/fractals/fotd/about.html> The temperature of 54F 12C made up for the limited sun here at Fractal Central today. Now that the winter to be remembered is winding down, and the snow and ice is quickly disappearing, the three fractal cats are giving more attention to the activity in the outside cat world. Lida has her eye on a big tough-looking orange tomcat that frequents the area, while Jasmine prefers a tuxedo colored tomcat. Nicholas simply watches the ladies silly behavior with aloof detachment, while the fractal people watch all three with puzzlement. The next FOTD will be posted, that much is certain, but only the invisible shadow knows when, and he's not talking. So until whenever, take care, and everyone should have at least one crazy conspiracy theory he can believe in without feeling silly. Jim Muth jimmuth(a)earthlink.net START PARAMETER FILE======================================= Fractals-101 { ; time=very brief SF5 at 2000MHZ reset=2004 type=formula formulafile=basicer.frm formulaname=SliceJulibrotSqr center-mag=0/0/0.86 params=0/0/90/0/-0.8/0/0/0/0/0 float=y passes=1 maxiter=750 inside=0 symmetry=xyaxis periodicity=6 colors=0004Ct5Et6Gt7It8Kr9MrAOrBQqCSqGUpIWpLXoNYnR\ ZmT_kX`i_`ga`e`adZbdXacQacKabEab8cb7dg6hk5jo4ksDic\ MgOVe8ZcBaaEe_HhYJkWMoUPrSSuQUwOUwMUwLUwJUwHUwGUwK\ TwNSwQSwURwXQw_Qw`PwaPwbPwbPwYNwULwPKjOqjOqkPqkPql\ QqmQqmQqnRqnRqoSqoSqpSqpTqqTqrUqrUqsVqsVqtVqtWquWq\ vXqvXqwXqwYqxYqxZqyZqz_ryZqyZqyYqyYqyYqyXqyXqyXqyW\ qxWqxWqxVpxVpxVpxUpxUpxUpxTpwTpwSpwSpwSpwRowRowRow\ QowQovQovPovPovPovOovOovOovNnvNnuMnuMnuMnuLnuLnuLn\ uKnuKnuKntJmtJmtJmtImtImtImtHmtHmtHmsGmsGmsFlsFlsF\ lsElsElsElsDlrDlrDlrClrClrClrBkrBkrBkrAkqAkq9kq9kq\ 9kq8kq8kq8kq7jq7jp7jp6jp6jp6jp5jp5jp5jp4jp4jo0lp4j\ q7iqAhrEfrHesKdsOctRatU`uY_v`YvcXwgWwjVxmTxqSytRzx\ PywQxvQxvRwuRvtSvtSusSurTtrTsqUszUrzUqzVqzVpzWpzWo\ zWnzXnzXmzYmzYlzZkzZkzZjz_iz_iz`hz`hz`gzafzafzbezb\ ezbdzcczcczdbzdazeaze`ze`zf_zfZzgZzgYzgYzhXzhWziWz\ iVziUzjUzjTzkTzkSzlRzlRzl } frm:SliceJulibrotSqr {; draws all slices of Julibrot pix=pixel, u=real(pix), v=imag(pix), a=pi*real(p1*0.0055555555555556), b=pi*imag(p1*0.0055555555555556), g=pi*real(p2*0.0055555555555556), d=pi*imag(p2*0.0055555555555556), ca=cos(a), cb=cos(b), sb=sin(b), cg=cos(g), sg=sin(g), cd=cos(d), sd=sin(d), p=u*cg*cd-v*(ca*sb*sg*cd+ca*cb*sd), q=u*cg*sd+v*(ca*cb*cd-ca*sb*sg*sd), r=u*sg+v*ca*sb*cg, s=v*sin(a), esc=imag(p5)+9 c=p+flip(q)+p3, z=r+flip(s)+p4: z=z*z+c |z|< esc } END PARAMETER FILE=========================================

1 0

Lack of memory crash
by Niekamp 16 Mar '15

16 Mar '15

This is what I´ve been told to do on my request to fix the lack of memory crashes caused by the latest fractint update. /"You just need to back off on the demands of your fractals// //so they are not at the edge of Fractint's capabilities."/ This means the end of my multifractal project after 12 years, nothing less. So the last Mohawk has to go. Albrecht

5 9

Stone soup
by Niekamp 14 Mar '15

14 Mar '15

Re: Bill Jamison ; After reading his rant again I´m unable to detect anything else but brainless animosity. There is nothing to discuss - plain hatred is beyond my horizon and I refuse to even deal with unsubstantial instincts. After all this is still a fractal forum and people that possible run around with black hoods dont belong here. So Mr.Jamison slap your breast like a Chimp and be proud. Sorry, Tim - that´s it. Albrecht

2 1

Stone Soup
by Bill Jemison 13 Mar '15

13 Mar '15

It's time for some soul-searching. When someone who has been generously handed bowls of stone soup, lovingly made from that most delicious of recipes, for years, free of charge and chock-full of wondrous fractal ingredients, starts picking out the stones and throwing them at the cooks...that person needs to do some serious introspection. In my 25 years of being a member of this community I have never seen this sort of ungrateful, selfish disrespect. Tim will never say it, but Stone Soupers should be of one voice on this. Bill Jemison

3 3

Lack of memory crash
by JackOfTradeZ＠comcast.net 13 Mar '15

13 Mar '15

. FYI - I simply used the previous version of FractInt and was able to render the latest multifractals no problemo! Don't quit! .

1 0

Lack of memory crash
by Niekamp 13 Mar '15

13 Mar '15

This is what I´ve been told to do on my request to fix the lack of memory crashes caused by the last fractint update. /"You just need to back off on the demands of your fractals// //so they are not at the edge of Fractint's capabilities./" This means the end of my multifractal project after 12 years, nothing less. So the last Mohawk has to go. Albrecht

1 0

Civil War
by Niekamp 11 Mar '15

11 Mar '15

This is the last (and best) in this series, very well hidden and very slow due maxiter 15.000. Seems to be some kind of a mandel, not sure. Special is also the crosswise symmetry like a Julia, 25176-32 in the folder. Re the lack of memory crash - please advise if you´re having the same problem after the update. Have asked Tim for assistance. ; https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqnAa?dl=0 ; Albrecht ; -----------------------------Start Par------------------------------------ 25176-32 { ; Civil War ; "The Battle" Zoom ; Time 0.38.16.21 Reso 1280/1024 ; Albrecht.map Maxiter 15.000 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=cotan/exp/acos/abs passes=t center-mag=-0.49999999999694040/+0.66082268875302250/2.506123e+009 params=-0.3126316110721153/-0.3126316110721153/25176.32004910757/15423.2\ 207130221/151024.0204808192/184.327685241141/224.98959000415/384.1017683\ 001/512.30009800861/48.10014800084299 float=y maxiter=15000 inside=maxiter periodicity=0 rseed=-2436 colors=0002WI<3>3LA4J84G54D3<17>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4K\ A0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc\ <9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>00\ 0<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0w\ c<9>2YK } ----------------------------------------End--------------------------------

1 0

formulafile=mfr_14.frm formulaname=mfr_14_2
by JackOfTradeZ＠comcast.net 10 Mar '15

10 Mar '15

. Anyone get memory errors (the fractint red screen of death) trying to do these? I couldn't render the last one . ----- Original Message -----From: fractint-request(a)mailman.xmission.comTo: fractint(a)mailman.xmission.comSent: Tue, 10 Mar 2015 18:00:13 -0000 (UTC)Subject: Fractint Digest, Vol 145, Issue 4 Send Fractint mailing list submissions to fractint(a)mailman.xmission.com To subscribe or unsubscribe via the World Wide Web, visit https://mailman.xmission.com/cgi-bin/mailman/listinfo/fractintor, via email, send a message with subject or body 'help' to fractint-request(a)mailman.xmission.com You can reach the person managing the list at fractint-owner(a)mailman.xmission.com When replying, please edit your Subject line so it is more specificthan "Re: Contents of Fractint digest..." Today's Topics: 1. The Battle (Niekamp) 2. Complensity (Niekamp) 3. Fratricidal War (Niekamp) ---------------------------------------------------------------------- Message: 1Date: Mon, 09 Mar 2015 19:04:22 +0100From: Niekamp <Niekamp(a)ish.de>To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com>Subject: [Fractint] The BattleMessage-ID: <54FDE0A6.4050401(a)ish.de>Content-Type: text/plain; charset=utf-8; format=flowed David said:Big Mama's Domain looks like it's full of war and fierce conflict! - and looking again he?s right.But what do you expect living on the edge of a universal war,lunacy against humanity with open end.My pay-tv provider features 8 movie channels without commercialbreaks. Yesterday tried to find one without blood and shooting:Failed!Today?s image was planned to be a peaceful one - using thetriple mandel background resembling of medieval fold uppaintings. Secant and Newton left and right, Manymods outside,and Phoenix in between.Your guess is right, the result is the same againusing a different fractal language. So be it.To put it together was some kind of puzzle, especiallymodifying each channel separately. With a small screensome details remain unvisible like watching HD ona smartphone.;https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UG… Par--------------------------------- 25176-04 { ; The Battle ; Mandel-ManyMods-Secant-Newton-Phoenix ; Time 0.04.36.23 Reso 1280/1024 ; Map Jim - All channels active and modified reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.509773/2.22045e-016/1.093843/1/180 params=-0.3126316110721153/-0.3126316110721153/25176.02004910757/15423.2\ 207130221/151024.0204808192/384.32768524288/1222.98959000495/384.1027683\ 001/512.30012800861/48.10144800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000LJI000000000IHG<23>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<\ 3>612301pUn<49>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3>1\ 10wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<9>LKI }----------------------------------End-------------------------------------- ------------------------------ Message: 2Date: Tue, 10 Mar 2015 14:46:08 +0100From: Niekamp <Niekamp(a)ish.de>To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com>Subject: [Fractint] ComplensityMessage-ID: <54FEF5A0.1080608(a)ish.de>Content-Type: text/plain; charset=utf-8; format=flowed The title needs no explanation.One of many zooms into yesterday?s image.;https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqnAa… Par------------------------------- 25176-15 { ; Complensity ; Zoom into "The Battle" ; Time 0.10.55.38 Reso 1280/1024 ; SG Map - XP Dos reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.0504058/1.66533e-016/10.93843/1/-90/3.88578058618804789e-0\ 16 params=-0.3126316110721153/-0.3126316110721153/25176.16004910757/15423.2\ 207130221/151024.0204808192/184.32768524288/224.98959000395/384.10176830\ 01/512.30009800861/48.10014800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=0005U30Z11b08e0Jh1Xi3ij6si9ygExdIr`NgXRVSVHMY6H_0C`08`64ZH2XU0Ug0\ Qr0Mx2Hy5Ds98iD5XI2JN08S01X00a25d4Fg7SiCejGpiKxhPyeTuaWkYZZT_LO`AJ_2EY09\ V46SD3OQ1Jc0Fo0Aw17y43v71mB0`G0OL1BQ33V60_93cEBfINhN`iRmiVvhYyf_wc`o_`cV\ ZQQXDLU4GQ0BM27H93DL18Z05k02u10y30x60pA2eF4SK7FPC5UG0ZK1bP8eTJhWXiZij_si\ `yg_xdYr`VgXSVSOHMJ6HF0CA087643H21U00g00r01x23y56s99iDEXIIJNN8SR1XV0aY5d\ _Fg`Si`ejZpiXxhUyeQuaMkYHZTDLO8AJ52E2090460D30Q12c04o07w1Cy4Gv7KmBP<2>BQ\ Z3V_0_`3c_BfYNhV`iSmiOvhJyfFwcAo_7cV3QQ1DL04G00B1273936L19Z0Ek0Iu1Ny3Rx6\ VpAYeF_SK`FP`5UZ0ZX1bU8eQJhMXiHijDsi8yg5xd2r`0gX0VS0HM26H40C708C64GH2KU0\ Pg0Tr0Wx2Zy5_s9`iD_XIYJNV8SS1XO0aJ5dFFgASi7ej3pi1xh0ye0ua1kY3ZT6LO9AJE2E\ I09N46RD3VQ1Yc0_o0`w1`y4Zv7XmBU<2>BQH3VD0_83c5Bf2Nh0`i0mi0vh2yf4wc7o_CcV\ GQQKDLP4GT0BW27Z93_L1`Z0_k0Yu1Vy3Sx6OpAJeFFSKAFP7 }--------------------------------------End---------------------------------- ------------------------------ Message: 3Date: Tue, 10 Mar 2015 18:11:05 +0100From: Niekamp <Niekamp(a)ish.de>To: Fractint and General Fractals Discussion <fractint(a)mailman.xmission.com>Subject: [Fractint] Fratricidal WarMessage-ID: <54FF25A9.1070304(a)ish.de>Content-Type: text/plain; charset=utf-8; format=flowed There are some more zooms, watch thefolder, but one is special - never seen -and part of the theme:Fratricidal War - 25176-21;https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqn… Par-----------------------------25176-21 { ; Fratricidal War ; Zoom into "The Battle" ; Time 0.10.55.38 Reso 1280/1024 ; Albrecht.map XP Dos reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.49999931712288650/-0.66262602849742660/5112.411/1/180 params=-0.3126316110721153/-0.3126316110721153/25176.32004910757/15423.2\ 207130221/151024.0204808192/184.327685241141/224.98959000415/384.1017683\ 001/512.30009800861/48.10014800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=0002TG<3>4J84G54D3<17>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA00\ 00<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>\ UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7\ >Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<1\ 0>2WI }------------------------------------End------------------------------------ ------------------------------ Subject: Digest Footer _______________________________________________Fractint mailing listFractint@mailman.xmission.comhttps://mailman.xmission.com/cgi-bin/mailman/listinfo/fractint ------------------------------ End of Fractint Digest, Vol 145, Issue 4****************************************

2 2

Fratricidal War
by Niekamp 10 Mar '15

10 Mar '15

There are some more zooms, watch the folder, but one is special - never seen - and part of the theme: Fratricidal War - 25176-21 ; https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqnAa?dl=0 ; Albrecht ; -----------------------------------Start Par----------------------------- 25176-21 { ; Fratricidal War ; Zoom into "The Battle" ; Time 0.10.55.38 Reso 1280/1024 ; Albrecht.map XP Dos reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.49999931712288650/-0.66262602849742660/5112.411/1/180 params=-0.3126316110721153/-0.3126316110721153/25176.32004910757/15423.2\ 207130221/151024.0204808192/184.327685241141/224.98959000415/384.1017683\ 001/512.30009800861/48.10014800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=0002TG<3>4J84G54D3<17>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA00\ 00<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>\ UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7\ >Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<1\ 0>2WI } ------------------------------------End------------------------------------

1 0

Complensity
by Niekamp 10 Mar '15

10 Mar '15

The title needs no explanation. One of many zooms into yesterday´s image. ; https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqnAa?dl=0 ; Albrecht ; ----------------------------------Start Par------------------------------- 25176-15 { ; Complensity ; Zoom into "The Battle" ; Time 0.10.55.38 Reso 1280/1024 ; SG Map - XP Dos reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.0504058/1.66533e-016/10.93843/1/-90/3.88578058618804789e-0\ 16 params=-0.3126316110721153/-0.3126316110721153/25176.16004910757/15423.2\ 207130221/151024.0204808192/184.32768524288/224.98959000395/384.10176830\ 01/512.30009800861/48.10014800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=0005U30Z11b08e0Jh1Xi3ij6si9ygExdIr`NgXRVSVHMY6H_0C`08`64ZH2XU0Ug0\ Qr0Mx2Hy5Ds98iD5XI2JN08S01X00a25d4Fg7SiCejGpiKxhPyeTuaWkYZZT_LO`AJ_2EY09\ V46SD3OQ1Jc0Fo0Aw17y43v71mB0`G0OL1BQ33V60_93cEBfINhN`iRmiVvhYyf_wc`o_`cV\ ZQQXDLU4GQ0BM27H93DL18Z05k02u10y30x60pA2eF4SK7FPC5UG0ZK1bP8eTJhWXiZij_si\ `yg_xdYr`VgXSVSOHMJ6HF0CA087643H21U00g00r01x23y56s99iDEXIIJNN8SR1XV0aY5d\ _Fg`Si`ejZpiXxhUyeQuaMkYHZTDLO8AJ52E2090460D30Q12c04o07w1Cy4Gv7KmBP<2>BQ\ Z3V_0_`3c_BfYNhV`iSmiOvhJyfFwcAo_7cV3QQ1DL04G00B1273936L19Z0Ek0Iu1Ny3Rx6\ VpAYeF_SK`FP`5UZ0ZX1bU8eQJhMXiHijDsi8yg5xd2r`0gX0VS0HM26H40C708C64GH2KU0\ Pg0Tr0Wx2Zy5_s9`iD_XIYJNV8SS1XO0aJ5dFFgASi7ej3pi1xh0ye0ua1kY3ZT6LO9AJE2E\ I09N46RD3VQ1Yc0_o0`w1`y4Zv7XmBU<2>BQH3VD0_83c5Bf2Nh0`i0mi0vh2yf4wc7o_CcV\ GQQKDLP4GT0BW27Z93_L1`Z0_k0Yu1Vy3Sx6OpAJeFFSKAFP7 } --------------------------------------End----------------------------------

1 0

The Battle
by Niekamp 09 Mar '15

09 Mar '15

David said: Big Mama's Domain looks like it's full of war and fierce conflict! - and looking again he´s right. But what do you expect living on the edge of a universal war, lunacy against humanity with open end. My pay-tv provider features 8 movie channels without commercial breaks. Yesterday tried to find one without blood and shooting: Failed! Today´s image was planned to be a peaceful one - using the triple mandel background resembling of medieval fold up paintings. Secant and Newton left and right, Manymods outside, and Phoenix in between. Your guess is right, the result is the same again using a different fractal language. So be it. To put it together was some kind of puzzle, especially modifying each channel separately. With a small screen some details remain unvisible like watching HD on a smartphone. ; https://www.dropbox.com/sh/77ds5b3eh4vbvbg/AAB9Q_amhSzxj-emi0UGQqnAa?dl=0 ; Albrecht ; -------------------------------Start Par--------------------------------- 25176-04 { ; The Battle ; Mandel-ManyMods-Secant-Newton-Phoenix ; Time 0.04.36.23 Reso 1280/1024 ; Map Jim - All channels active and modified reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/exp/acos/abs passes=t center-mag=-0.509773/2.22045e-016/1.093843/1/180 params=-0.3126316110721153/-0.3126316110721153/25176.02004910757/15423.2\ 207130221/151024.0204808192/384.32768524288/1222.98959000495/384.1027683\ 001/512.30012800861/48.10144800084299 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000LJI000000000IHG<23>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<\ 3>612301pUn<49>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3>1\ 10wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<9>LKI } ----------------------------------End--------------------------------------

1 0

Big Mama´s Domain
by Niekamp 08 Mar '15

08 Mar '15

And this is Big Mama´s Domain. ; https://www.dropbox.com/sh/x2ncxrp84k6rnwr/AAD3x1DzNa_3emBm4nVN6kjea?dl=0 ; Albrecht ; -------------------------------Start Par---------------------------------- 50205-11 { ; Big Mama`s Domain ; Mmods-Mandel-Mmods ; Time 0.17.37.53 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/sin/ident/asin passes=t center-mag=-0.98255108658667150/+0.04826961091397615/103502.7/1/92.99999\ 99998831584/1.64918509404365921e-010 params=-0.05825983458967864/0.3785210730307932/50205.64595710505/14235.4\ 911030602/152048.0404808048/384.1604894048/384.00482000595/256.100368300\ 1/512.1007683001/768.1011243001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } -----------------------------------End Par---------------------------------

2 1

Big Mama - A new Gown fir the Holy Grail
by Niekamp 08 Mar '15

08 Mar '15

A magniloquent title? Judge yourself. Anyway the gender IS feminine. A few days ago said to Tony "got to learn using the new freedom", that´s what I´m doing. ; https://www.dropbox.com/sh/x2ncxrp84k6rnwr/AAD3x1DzNa_3emBm4nVN6kjea?dl=0 ; Albrecht ; --------------------------------------Start Par-------------------------- 50205-07 { ; Big Mama ; A new Gown for the Holy Grail ; Time 0.22.03.92 Reso 1280/1024 ; Albrecht.map - All new freedoms used reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=log/sin/ident/asin passes=t center-mag=-1.00029573371745000/+0.04932618412989521/44.50616/1/-88.0000\ 000000001847/2.03941030729737349e-013 params=-0.05825983458967864/0.3785210730307932/50205.64595710505/14235.4\ 911030602/152048.0404808048/384.1604894048/384.00482000595/256.100368300\ 1/512.1007683001/768.1011243001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 sound=off colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } ------------------------------------------End------------------------------

3 2

Pinatubo
by Niekamp 06 Mar '15

06 Mar '15

Not much to say about this one, just an image to brighten up a grey day. ; https://www.dropbox.com/sh/hs275kx6phaoj9q/AABF-7j-H61dlZOeA8BiFW9ia?dl=0 ; Albrecht ; ---------------------------Start Par------------------------------------- 15367-09 { ; Pinatubo ; Secant-Mmods-Bees-Phoen-Newt ; Time 0.08.36.01 Reso 1280/1024 ; MFR_14_2 Albrecht.map reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=sin/tanh/sin/sin passes=t center-mag=-3.45265/-3.58047e-015/12.92235/1/90/-1.23373533611470521e-01\ 4 params=-0.05825983458967864/0.3785210730307932/15367.06595761671/15234.4\ 911030602/152048.0404808012/384.160489401111/384.00001014855/256.1033243\ 001/512.1001683001/768.1007683001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 colors=000<25>000000000<3>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zw\ m<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<\ 2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR\ 0C<3>A08004000 } ------------------------------------------End-Par--------------------------

1 0

Caleidoscope zoom - DosBox Configuration
by Niekamp 27 Feb '15

27 Feb '15

Tried the Fractint Patch on DosBox SVN-Daum and NO lack of memory crash. Everything works just perfectly and really fast. Here are the relevant settings I use on XP. Important is the fixed cycles amount which may be higher with faster systems and dynamic kernel allocation=false. The image, an exciting zoom, generated in hardly believable 2 min. ; core=dynamic cputype=auto cycles=fixed 205170 #cycles=max cycleup=10 cycledown=20 ignore opcode 63=true apmbios=false isapnpbios=true realbig16=falsexms=true ; ems=true umb=true umb start=0 umb end=0 dynamic kernel allocation=false keep umb on boot=false keep private area on boot=false private area in umb=true automount=true int33=true biosps2=true keyboardlayout=auto dbcs=true filenamechar=true collating and uppercase=true files=127 ; [autoexec] # Lines in this section will be run at startup. # You can put your MOUNT lines here. mount c k:\dosfiles\FRACTINT\ ; ; https://www.dropbox.com/sh/4nssoibe8t1yvpe/AAAGX7fGueqCkkKboUhT3DkKa?dl=0 ; The link also contains the "look closely" input table with the explanation how to change the default functions, 3 versions as usual. ; ---------------------------Start Par-------------------------------------- 13567-10 { ; Caleidoscope - Zoom ; Time 0.02.59.55 Reso 1280/1024 ; Used DosBox SVN Daum ; SGG051 Colormap reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-0.83011/2.61569e-013/24.19704/1/90/3.88578058618804789e-016 params=-0.05487228003784295/0.2096011230811487/13567.07595752022/12534.4\ 911030602/150512.0404808048/384.3204896048/384.00482000595/128.300768859\ 1/256.3007684001/512.2007681001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000ZS0<12>HC0GB0FA0<3>A60960850<3>521421312<3>103103003<3>0040050\ 05015016<3>237247348<8>BDBCECDFC<8>PQGQRGSTH<7>baKcbKdcL<3>igMjgNkhN<3>n\ kOokPplP<3>rmQrmRsmR<3>smSsmSslT<3>rkUqjUqiU<3>nfVmfVmeV<9>aVW`UW_SWYRWX\ QWWPW<9>IDWHCWFBW<3>B7VA6V95V<3>52U42U31T<3>10S10S00S<3>00R00Q00Q<3>12P1\ 2O13O<4>56M67M68M<8>GIIIJHJKH<6>TTEUUEVWD<4>a`BbaBdbB<3>hf9ig9jh8<3>nj7o\ k6pk6<3>rm5rm4sm4<4>sm3sl2sl2<3>rj1qj1qi1<11>fZ0eY0cX0<2>`T0 }

1 0

fractint 20.04 patch 13 - Hermaphrodite.par
by Niekamp 27 Feb '15

27 Feb '15

It was bugging me that for each image an integrated frm version was needed and also harddisk space consumed - so I´ve written a new universal version that is used all the times and is placed together with MFR14_1 in the FRM folder. It has default function settings to be replaced on request on the input screen and seems to work perfectly - without one exception: ; /The new fractint patch produces// //a lack of memory crash, so I must// //ask Jonathan again to try a fix./ ; I´m still using the old version which runs perfectly even in evolver mode. The new FRM is included in the par and will be used from now on. Note : The crash only happens in evolver mode, which is essential for me of course, so other users are NOT concerned. ; https://www.dropbox.com/sh/s587gf7uzkuxhf9/AADUta-E_K0sOzUvT6LhWt87a?dl=0 ; Albrecht ; --------------------------Start Hermaphrodite.par------------------------- frm:mfr_14_2 {; Albrecht Niekamp Feb.26,2015 Universal Twopass Version ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 mow=trunc(da/100) da=da-mow*100 mag=trunc(da/10) d=trunc(da-mag*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } 30001-23 { ; Hermaphrodite ; Bees-Secant ; Time 0.06.18.87 Reso 1280/1024 ; New MFR_14-2 universal version reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=+0.19084994759683450/-0.08758731763020938/4126.423/1/-37.5000\ 000000032188/2.30310909232755989e-012 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000IpA<2>GoFGnHFmK<3>DkTCjVCjYBi_Aha<3>8fj8el7dn<3>5au5`v4_w<3>3X\ z2Wz2Vz<3>1Ty1Sy1Rx<3>0Os0Nq0Mo0Ln<2>0Kg0Je0Ic0Ha0HZ<3>0EQ1DO1DL1CJ1001A\ F<3>288386375<3>551550640<3>830830921<3>B15C17C18<3>F0FF0HG0K<7>M0aN0cN0\ f<3>Q0nR1pS1q<3>V2wW2xX3y<3>_4z`4z`5z<3>c7xd7we8v<3>hAoiAniBl<5>mFZnGXoG\ V<3>qJMqKJrLH<3>tO9tO8uP6<3>wS2wT1wU0<3>xX0yY0yY0<3>za4za5zb7<3>zeDzfFzg\ H<4>zkSzkVzlXzl_zma<3>yojxplxpn<3>wstwtvvtw<3>uvztvztvz<3>rxyrxyqxx<3>nz\ snzqmzolzn<2>kzgjzeizchzahzZ<4>dzOczMbzJ<3>_yBZy9Zy8<3>Vx3Vx2Uw1<3>Rv0Qu\ 0Pu0<4>Ls4Lr5Kr7Jq8 } ------------------------------------End Par--------------------------------

2 2

Caleidoscope
by Niekamp 27 Feb '15

27 Feb '15

Jim called his latest image Caleidoscope. Here is my version. It was not intended. I just used a chaotic image done with MFR_10 some years ago and produced a good image with the new tools. The title of the old par was this one. The latest MFR_14_2 version - Default Functions - IS a step forward again, it seems. Once more: Please copy it into your frm folder together with MFR_14-1 as MFR_14.frm. Here are the two again - not included in the par. If you check it you´ll see that all functions are "ident" that means no modifications so far. Will see. ; https://www.dropbox.com/sh/4nssoibe8t1yvpe/AAAGX7fGueqCkkKboUhT3DkKa?dl=0 ; Albrecht ; ----------------------Start Par------------------------------------------ 13567a { ; Caleidoscope-a- ; time 06.01.25 ; sec-bees-mmods-phoen-newt reset=2004 type=formula formulafile=mfr_14.frm formulaname=mfr_14_2 function=ident/ident/ident/ident passes=t center-mag=-2.92251/2.61124e-013/0.1645399/1/90/3.88578058618804789e-016 params=-0.05825983458967864/0.3785210730307932/13567.07595752022/12534.4\ 911030602/150512.0404808048/384.3204896048/384.00482000595/128.300768859\ 1/256.3007684001/512.2007681001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000JM0<8>EH0DG0DG0<16>350240140<3>010000000<58>X00X00X00Y00Y00<22\ >fE0fF0fG0<16>jP0jQ0jQ0jQ0<21>lZ0l_0k_0<4>k`0k`0ka0<17>hc0hc0hc0<17>ba0b\ a0aa0<16>VX0VW0UW0UV0TV0<10>OQ0NQ0NP0MO0<3>KM0 } ----------------------End Par-------------------------------------------- ---------------------Start frm------------------------------------------- mfr_14_1 {; Albrecht Niekamp Feb.19,2015 Deleted Warp Effect ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 u=1.0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9 c=px0 p=pp else if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9 c=px1 p=pp else c=px1 z=z cb=p9 endif else vb=v1m if (rs1) c=z z=pixel*(sc1+po1) z0=p7 ph=ph else c=z endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9 c=px2 p=pp else cb=p9 c=px2 endif else vb=v2m if (rs2) c=z z=pixel*(sc2+po2) z0=p7 else c=z endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9 c=px3 p=pp else cb=p9 c=px3 endif else vb=v3m if (rs3) c=z z=pixel*(sc3+po3) z0=p7 else c=z endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (d3) vb=v4j if (rs4) z=pixel cb=p9 c=px4 p=pp else cb=p9 c=px4 endif else vb=v4m if (rs4) c=z z=pixel*(sc4+po4) z0=p7 else c=z endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=fn2(z)*fn3(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn1(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=fn3(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } mfr_14_2 {; Albrecht Niekamp Feb.26,2015 Default Functions ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Dig_bailout4 4 Dig_bailout5 1 Dig_mow=2 1 Dig_mag=2 1 Dig_fns ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*100000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/10000000) da=da-ba4*10000000 ba5=trunc(da/1000) da=da-ba5*1000 mow=trunc(da/100) da=da-mow*100 mag=trunc(da/10) d=trunc(da-mag*10) fdm=(d==4)+(d==7) fdb=(d==3)+(d==7) px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else if (fdm) Z2=fn4(z)+c else z2=sin(z)+c ;Many_mods endif z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else if (fdb) z1=fn3(z)-cb else z1=sin(z)-cb ;Bees endif z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } --------------------------------------End Frm----------------------------

1 0

Re: [Fractint] 76531.par - 3
by Hal Lane 26 Feb '15

26 Feb '15

Albrecht, > IÂ´m still playing with the "Circles"... http://tinyurl.com/DropBox-for-Circles-76531 or: https://www.dropbox.com/sh/0x71kstlg54b3xy/AABfUSXzJhdFLValHTnEzIxBa?dl=0 Once again I'm blown away by the variety of forms, shapes and details your MFR formulas can create! - Hal Lane ######################## # hallane(a)earthlink.net ######################## ========================================== Author: Niekamp Date: 2015-02-25 12:36 -500 To: Fractint and General Fractals Discussion Subject: [Fractint] 76531.par - 3 IÂ´m still playing with the "Circles" as hidden deep inside there are some mandel variations, although the mandel frm is not included. Fascinating is that there are two completely different kinds. Three more images have been added. Please copy and paste them into 76531.par ; https://www.dropbox.com/sh/0x71kstlg54b3xy/AABfUSXzJhdFLValHTnEzIxBa?dl=0 ; Albrecht ; ----------------------------Start Par------------------------------------ . . . ========================================== --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

3 3

Albrecht, You asked that I anti-alias your "Circles" image.
by Hal Lane 26 Feb '15

26 Feb '15

Albrecht, You asked that I anti-alias your "Circles" image. I tried, but the power went off during a storm -- but the batteries in my UPS let me save this partial image. I didn't want to lose it after ~2 days of calculating! So, this is what I have for you: (Click for full size...) http://www.emarketingiseasy.com/Albrecht/Misc/76500-04.jpg I'll go back and finish it later... And for the truly adventurous, here's the 3MB 3k x 4k .GIF http://www.emarketingiseasy.com/Albrecht/Misc/76500-04.GIF Click for full size, and scroll -- I kind of like to use the arrow keys to look around in a large image like this so I don't have to keep looking over at the two scroll bars each time I move my cursor between them... Your image has very pleasant gold colors, with nice pink and green accents -- with *lots* of detail in a great variety of patterns! - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

76531.par - 3
by Niekamp 25 Feb '15

25 Feb '15

I´m still playing with the "Circles" as hidden deep inside there are some mandel variations, although the mandel frm is not included. Fascinating is that there are two completely different kinds. Three more images have been added. Please copy and paste them into 76531.par ; https://www.dropbox.com/sh/0x71kstlg54b3xy/AABfUSXzJhdFLValHTnEzIxBa?dl=0 ; Albrecht ; ----------------------------Start Par------------------------------------ 76500-25 { ; Mandel on Bubbles ; time 0.27.07.55 1280/1024 ; newt-phoen-mmods ; deep inside the circles reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.34474237798238630/+0.00000000000026462/5.54925e+008/1/90/3\ .88578058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.160057555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000EDL76ASQN<38>432332321<3>000pO`<3>MAFF69734eFn<2>A3CJ56<3>6113\ 00pUm<49>635534423<3>000VO1<15>970860650<3>110zh2<35>A70860750<3>110wOM<\ 3>_ECUCAO98<2>621DL5<2>350gy1<44>580570450<3>010LKW } 76500-31 { ; Mandel on Stripes ; time 0.27.07.55 1280/1024 ; newt-phoen-mmods ; deep inside the circles reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.38667711506611910/+0.00000000000026462/568570.8/1/90/3.885\ 78058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.165557555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000sm4<3>sl3sl3sl3<3>qj2qi2ph2<9>g_0fZ0eY0<3>`T0ZS0YR0WP0VO0<9>HC\ 0GB0FA0<3>A61961851<3>522422313<3>104104004<3>005006006016017<3>23824834\ 9<8>BDCCEDDFD<8>PQHQRHSTI<7>baLcbLdcM<3>igNjgOkhO<3>nkPokQplQ<3>rmRrmSsm\ S<3>smTsmTslU<3>rkVqjVqiV<3>nfWmfWmeW<9>aVX`UX_SXYRXXQXWPX<9>IDXHCXFBX<3\ >B7WA6W95W<3>52V42V31U<3>10T10T00T<3>00S00R00R<3>12Q12P13P<4>56N67N68N<8\ >GIJIJIJKI<6>TTFUUFVWE<4>a`CbaCdbC<3>hfAigAjh9<3>nj8ok7pk7<2>qm6rm6rm5sm\ 5sm5 } 76500-32 { ; MagMa ; time 0.19.45.66 1280/1024 ; newt-phoen-mmods ; deep inside the circles reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.34474237925068780/+0.00000000080806178/2.708037e+009/1/90/\ 3.88578058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.160057555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000<3>000A00<20>QC8RD8SD9<13>dSFeTGgUG<3>kZIl_Jm`J<3>reMwww<42>CC\ CBBBAAA<3>555F00<10>SC7TD8VE9<2>YHB_JC_KC<24>tlWunXvoX<3>zt`rrr<42>GGGFF\ FEEE<3>AAAK00<42>rfQrgQshR<3>wmU000 } ------------------------------------------End-------------------------------

1 0

76531.par link
by Niekamp 25 Feb '15

25 Feb '15

https://www.dropbox.com/sh/qe46tkgdu1ywy1x/AAAM01oN-Bwvv2G5GqVEq8_ta?dl=0 sry. Albrecht

1 0

Evolution Animation
by JackOfTradeZ＠comcast.net 25 Feb '15

25 Feb '15

. The Mandelbrot Exponent was varied from 0.0 to 8.0 to create the effect. .

1 0

Re: [Fractint] Multiplosh
by Hal Lane 25 Feb '15

25 Feb '15

Oops! Mike, I forgot to include the link to a zoom into your Multiplosh that I did: http://www.emarketingiseasy.com/misc/M150223.jpg - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Mike, your 'Multiplosh' image reminds me of a Victorian doily.
by Hal Lane 25 Feb '15

25 Feb '15

Mike, your 'Multiplosh' image: https://dl.dropboxusercontent.com/u/33642054/image/multiplosh_1200_5.jpg reminds me of a "modern version" of a Victorian doily. Nice details. - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Circles - 76531.par
by Hal Lane 25 Feb '15

25 Feb '15

> HAL, this image is definetely suitable for > anti-aliasing. The calculation is under way... - Hal Lane ######################## # hallane(a)earthlink.net ######################## ============================================= Author: Niekamp Date: 2015-02-23 11:20 -500 To: fractint and General Fractals Discussion Subject: [Fractint] Circles - 76531.par Every longtime windows user knows it: there are some Win98 programs that under no circumstances will run under Win7, Fractint is only one of them. Same with images created with MFR_10, the version with the most experiments: Border system, Warp Effect, selectable bailout, 3 different reset settings between the channels and as many pitfalls. For those cases I have an "oldies" folder and from time to time I give it a try to recreate an image. MFR_14-1 is down compatible and can ignore some of those traps. I have tried many times to recreate todayÂ´s v e r y special image and finally succeeded. Not exactly identical, that is impossible but maybe even better. It is so special because the Newton parent Frm uses the Manymods circles for itÂ´s own characteristic structures and this is still the only image with that effect. So the two pass generation is good for more then just modifications. HAL, this image is definetely suitable for anti-aliasing. ; Albrecht ; ============================================= --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Eveolution - Zooms
by Hal Lane 25 Feb '15

25 Feb '15

Thanks, JoTz, Albrecht! - Hal Lane ######################## # hallane(a)earthlink.net ######################## ======================================= Author: JackOfTradeZ Date: 2015-02-22 17:05 -500 To: fractint New-Topics: Re: [Fractint] Eveolution - Zooms Subject: [Fractint] 2 Pass Images - Zooms . The 6 images are rendered at 1400x1050 ; took less time than I thought. http://www.fractal-animation.net/1400.zip ========================================= --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Evilution
by Hal Lane 25 Feb '15

25 Feb '15

JoTz, Did you gradually increment the power that Z is raised to between the frames of your great video, "Evilution?" - Hal Lane ######################## # hallane(a)earthlink.net ######################## ===================================== Author: JackOfTradeZ Date: 2015-02-22 13:49 -500 To: fractint Subject: [Fractint] Evilution . See the Mandelbrot. See the Mandelbrot grow. Grow Mandelbrot Grow! . http://www.fractal-animation.net/vid/evolution.zip . 30MEG, 1min 48sec; 640WMV ===================================== --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Jim Muth's FOTD images for Feb 9 & 20 & variations are up
by Hal Lane 25 Feb '15

25 Feb '15

Jim Muth's FOTD images for February 9th and 20th, 2015 -- and my variations on them (all anti-aliased at 1200 x 900) are now available on my site: http://www.emarketingiseasy.com/TESTS/FOTD/jim_muths_fotd.html Again, thanks for navigating thru my main page (above) to keep my counters up-to-date. - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Fractint version 20.04 patch 12 released
by Jonathan Osuch 25 Feb '15

25 Feb '15

Folks, Fractint version 20.04 patch 12 was released today. The executables can be found at: www.fractint.net or www.fractint.org Here is what's new: Fixed buffer overflow in disk video mode when savename was too long. Jonathan

5 10

76531.par 2
by Niekamp 24 Feb '15

24 Feb '15

Due to yesterday´s lack of memory crash with the new 20.04 patch I have shortened the frm. That was possible as no function conflicts are left. Also the 2 pass procedure has been simplified so it takes only a couple of minutes more to create a new image. If it is of no concern to you that the frm is searched for some seconds you can copy it into the main frm folder too. The difference is that it is always available. Took the opportunity to add some zooms and a better colored version of the parent image. The "Mandel Ghost" has some simularity with Jack´s "Evilution", not intended of course. ; Just overwrite yesterday´s par. Albrecht ----------------Start 76531.par------------------------------------------- frm:mfr_14_2_76531 {; Albrecht Niekamp Feb.23,2015 ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=sin(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=sin(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } 76531z06 { ; Circles ; time 0.16.06.59 1280/1024 ; newt-phoen-mmods-bees-sec reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.416945/2.64622e-013/8.670704/1/90/3.88578058618804789e-016 params=-0.05825983458967864/0.3785210730307932/76531.16595750023/34531.4\ 911030602/150512.0404808048/384.3204896048/384.00482000595/512.200000859\ 1/256.2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000D7C<6>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3>\ 110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<38>4\ 33333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<41>D7D } 76500-04 { ; Circles 2 ; time 0.16.06.59 1280/1024 ; newt-phoen-mmods-bees-sec reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.416945/2.64622e-013/8.670704/1/90/3.88578058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.165557555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000EB0<3>970860650<3>110zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>6\ 22DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<38>433333322<3>000pOa<3>MA\ GF6A735eFo<2>A3DJ57<3>612301pUn<49>636535424<3>000VO2<10>GC1 } 76500-18 { ; Mandel Ghost ; Time 0.18.16.14 Reso 1280/1024 ; newt-phoen-mmods reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.33727986491130420/+0.00000000000026462/42221.97/1/90/-1.23\ 373533611470521e-014 params=0.5267637918811443/-0.1364881926697067/76500.160057555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000735eFo<2>A3DJ57<3>612301pUn<49>636535424<3>000VO2<15>970860650\ <3>110zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>5805704\ 50<3>010LKXEDM76BSQO<38>433333322<3>000pOa<4>F6A } 76500-15 { ; Newton Net ; Time 0.24.02.23 Reso 1280/1024 ; newt-phoen-mmods reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.33707018591452040/+0.00000000000026462/3468.282/1/90/-1.23\ 373533611470521e-014 params=0.5267637918811443/-0.1364881926697067/76500.160057555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000735eFo<2>A3DJ57<3>612301pUn<49>636535424<3>000VO2<15>970860650\ <3>110zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>5805704\ 50<3>010LKXEDM76BSQO<38>433333322<3>000pOa<4>F6A } 76500-13 { ; Multi Kulti ; Time 0.00.45.15 Reso 1280/1024 ; newt-phoen-mmods reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.38568270801581950/-0.00000006492408255/468940.2/1/90/-1.23\ 373533611470521e-014 params=0.5267637918811443/-0.1364881926697067/76500.165557555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000_Q1<17>A70860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580\ 570450<3>010LKXEDM76BSQO<38>433333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3\ >612301pUn<49>636535424<3>000VO2<15>970860650<3>110zh3<16>aR1 } 76500-09 { ; Underworld ; Time 0.04.41.16 Reso 1280/1024 ; newt-phoen-mmods reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.38724983270273070/+0.00000000000026462/1421.427/1/90/3.885\ 78058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.165557555/34531.4911\ 030602/150512.0404808048/0.3204896048/224.00482000595/24.2000008591/256.\ 2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000rm5<3>sm4sm4sm4<3>rk3rk2rj2<3>oh1og1nf1<6>g_0fZ0eY0<3>`T0ZS0YR\ 0WP0VO0<9>HC0GB0FA0<3>A61961851<3>522422313<3>104104004<3>00500600601601\ 7<3>238248349<8>BDCCEDDFD<8>PQHQRHSTI<7>baLcbLdcM<3>igNjgOkhO<3>nkPokQpl\ Q<3>rmRrmSsmS<3>smTsmTslU<3>rkVqjVqiV<3>nfWmfWmeW<9>aVX`UX_SXYRXXQXWPX<9\ >IDXHCXFBX<3>B7WA6W95W<3>52V42V31U<3>10T10T00T<3>00S00R00R<3>12Q12P13P<4\ >56N67N68N<8>GIJIJIJKI<6>TTFUUFVWE<4>a`CbaCdbC<3>hfAigAjh9<5>pk7pl7ql6qm\ 6rm6 } 76500-22 { ; Symmetry*four ; Time 0.04.41.16 Reso 1280/1024 ; newt-phoen-mmods reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.39505063082768110/+0.00000000000026462/346427.9/0.7151/90/\ 3.88578058618804789e-016 params=0.5267637918811443/-0.1364881926697067/76500.165557555/34531.4911\ 030602/150512.0404808048/0.3204896048/44.00482000595/16.2000008591/256.2\ 000004001/512.3000008001 float=y maxiter=1048 inside=maxiter periodicity=0 rseed=-2436 colors=000B003z009N00000000004C00Oa00xd0000000000A40000<6>00000000AM0000\ 000000Op00000<4>000<2>0000An00HG00Kj0000<10>000<4>00000Gg00H800GF00Aq000\ 0000000A100<3>00000000v000<2>00000D000<17>000<4>000cAAzcmwwwKKKcccKKKccc\ KKKcccKKKcccKKKcccKKKcccKKKcccKKKccc000KKKcccKKKcccKKKcccKKKcccKKKcccKKK\ cccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKK\ cccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKK\ cccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKK\ cccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKcccKKKKKK000<6>000<3>000\ 00100MK00000<3>0000G8000<2>000006G00000000 } --------------------------------------End Par-------------------------------

1 0

Multiplosh
by Mike Frazier 23 Feb '15

23 Feb '15

I found this fractal while experimenting with different terms in the parallel resistor formula. In this variation I multiplied cosh times sinh and mixed it with z: z=1/(1/(-1 * (cosh(z) - 1) * sinh(z) + pixel + 1) + 1/(-1 * z^3 + pixel - 1)) The equation was constructed so that the minimum power of z representing the series for each term is 3. All the minibrots in the fractal are order 3. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/multiplosh_1200_5.jpg The FractInt compatible PAR file for the image is: Multiplosh { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150223_1612 passes=1 float=y center-mag=-3.269199343709963/0/2656681.533233844/\ 1/0/0 params=-1/-1/0/3/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=0000000000000000000000000000000000000000000\ 00000000000000000000000000000000600F00O00X00e00V00\ L00A00UMFaULj`RrhYzocshYkaScVMWOH000700J00U00d00a0\ 0Q00F00300WWb``geemjjroowkkrffmaahZZeUU`215B4KK8ZS\ Bm`HvjPttXrzdkzkWzsFzz0tpDmdRfUdZIsaJvfMunSsuYrzam\ z_czYVzWL00083FH7UPAhXFw_9ca4Jd00kCIsPZxXjzfdzoOzw\ 6ztDzjXz`prPZiCI`00_4GZ8XYClUDqK9_A4I000000300900F\ 00L00O00U00_00e00b00V00O00H00D00600UMFZRJdWNgZPlcU\ rhYxmazocuk_pfWkaSh_QcVMZRJUMF000300B00J00Q00U00a0\ 0h00a00Y00Q00J00B00700000WWbZZe``gcckggnjjrmmuoowm\ mtiipffmddlaahZZeWWbUU`00052AB4KE6PK8ZPAhVDr`HvcKv\ jPtqUswZqzapzffzkWzqLzsFzx5xw4tpDohNmdRhY`cQiZIsXF\ waJvfMukQtnSssWrx_qzamz`jz_czZYzXSzWLyVI00052AB4KE\ 6PK8ZPAhVDrXFwZBj`7Xa4Jb2Cd00i8CnGOsPZuTdz`pzfdzlT\ zoOzuCzz0ztDzqKzjXzcjwXjuTdoKTiCIc46`15_2B_5MZ8XYB\ gYClXFwQCkK9_G7UA4I316000 } frm:F_20150223_1612 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2),d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(cosh(z)-1)*sinh(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

Circles - 76531.par
by Niekamp 23 Feb '15

23 Feb '15

Every longtime windows user knows it: there are some Win98 programs that under no circumstances will run under Win7, Fractint is only one of them. Same with images created with MFR_10, the version with the most experiments: Border system, Warp Effect, selectable bailout, 3 different reset settings between the channels and as many pitfalls. For those cases I have an "oldies" folder and from time to time I give it a try to recreate an image. MFR_14-1 is down compatible and can ignore some of those traps. I have tried many times to recreate today´s v e r y special image and finally succeeded. Not exactly identical, that is impossible but maybe even better. It is so special because the Newton parent Frm uses the Manymods circles for it´s own characteristic structures and this is still the only image with that effect. So the two pass generation is good for more then just modifications. HAL, this image is definetely suitable for anti-aliasing. ; Albrecht ; ----------------------------76531.Par-------------------------------------- 76531z06 { ; Circles ; time 0.16.06.59 1280/1024 ; newt-phoen-mmods-bees-sec reset=2004 type=formula formulafile=76531.par formulaname=mfr_14_2_76531 function=ident/ident/ident/cos passes=t center-mag=-0.416945/2.64622e-013/8.670704/1/90/3.88578058618804789e-016 params=-0.05825983458967864/0.3785210730307932/76531.16595750023/34531.4\ 911030602/150512.0404808048/384.3204896048/384.00482000595/512.200000859\ 1/256.2000004001/512.3000008001 float=y maxiter=3071 inside=maxiter outside=tdis periodicity=0 rseed=-2436 colors=000D7C<6>636535424<3>000VO2<15>970860650<3>110zh3<35>A70860750<3>\ 110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<38>4\ 33333322<3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<41>D7D } frm:mfr_14_2_76531 {; Albrecht Niekamp Feb.18,2015 ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn4(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=sin(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ---------------------------------------------------End-------------------------------------------

1 0

FOTD 20-02-15 (Kaleidoscope [A-8,M-5])
by Jim Muth 23 Feb '15

23 Feb '15

FOTD -- February 20, 2015 (Rating A-8,M-6) Fractal visionaries and enthusiasts: Joy to the world, for I am still here, though my humility keeps me from broadcasting the glorious news. I have been here every day for almost 18 years, and I have no intention of going away in the foreseeable future. Fractals are simply too much fun. Today's, or perhaps I should say this fortnight's, fractal lies in the Mandeloid that comes about when 2 negative parts of Z^(-1.9) are combined with 1 negative part of Z^(-4.5) and (1/Z) is added on each iteration to produce a sprawling parent fractal with a large but distorted Mandeloid minibrot at the center. Today's scene lies on a filament extending from a sub-bud of a large bud on the northeast shore line of the main bay of the distorted Mandeloid. I named the image "Kaleidoscope" because of the rich colors. I gave it an artistic value of 8 and a math value of 6. The image calculates in 1-1/3 minutes . . . that is if anyone still bothers to calculate parameter files by hand. And a trip to the web sites can remove the task of calculation. To avoid calculation, check the web sites at: <http://www.crosscanpuzzles.com/Archives.html> <http://www.emarketingiseasy.com/TESTS/FOTD/jim_muths_fotd.html> <http://www.Nahee.com/FOTD/> <http://user.xmission.com/~legalize/fractals/fotd/about.html> The temperature rose from a morning low of -6F -21C to an afternoon high of 9F -13C here at Fractal Central today, though the brilliant sun cut a bit of the chill, at least in the spots sheltered from the wind. The fractal cats must have found the window shelf too drafty, since they settled in the stray patches of sunlight falling on the floor. The fractal humans made it through the day glad that the heat is working. The next FOTD will be posted when I get a round tuit. Until whenever, take care, and I hear that some so-called climate scientists are claiming that the present extreme cold is a result of Arctic warming caused by man-made climate change. They might convince idealistic but ignorant progressives, who really do care about the earth, but as for me, I know a money- backed political agenda when I see one. Jim Muth jimmuth(a)earthlink.net START PARAMETER FILE======================================= Kaleidoscope { ; time=0:01:20.00 SF5 at 2000MHZ reset=2004 type=formula formulafile=basicer.frm formulaname=MandAutoCritInZ function=recip passes=1 center-mag=+1.999621640252/+0.034880316975/1e+007/\ 1/-15/0 params=-2/-1.9/-1/-4.5/0/0/0/0 float=y maxiter=1500 inside=0 logmap=75 periodicity=6 colors=00000M00L00K00J00I00H00F00E00D00C00B00A0090\ 08007006005004003002001_zzzr0Vqmmj0Qiccb0L`UUV0GTK\ PPGBLGJI07H9AAAAAA9azhVz8YrcSm7VmZPc6SfUMX5PYPIT4M\ TPFM3JKKCH3GFE9D2CBA68196534062zRhzPemOcgM`dLZbJX_\ IUXHSUFQRENPCLMBIJ9GG8ED7BB59847524212fJ1bH0_G0XE0\ UD0RC0OA0L90I80F60C50940620310te5qc4oa4l_4jZ4hX3eV\ 3cT3aS3ZQ3XO2UM2SL2QJ2NH2LF1JE1GC1EA1B819707504302\ 10OdZMaWKZUJWSHUPGRNEOLCLIBJG9GE8DBojaojaoiaoiapha\ ph`pg`pg`pg`pf`pf_pe_qe_qd_qd_qcZqcZqbZqbZqbZo_WmY\ UkVSiTPCRXDQYEPYFPYFOYGNYHNYIMYILYJLYKKYLJYLJZMIZN\ HZOHZOGZPFZQFZREZRDZSDZTCZTCZSHXSLVRPTRTRRXPTYRVYT\ XYUZYW`ZXbZZdZ_fZah_bj_dl_en_gp`hr`jt`kv`mw`nuaotc\ orhoqmopronvomzokzojzoizogzpfzpdzpczpbzp`zp_zpZzpX\ zpWzpUzqTzqSzqQzqPzqNzqMzqLzqJzzIzzHzzKzzNzzQzzTzz\ WzzYzz`zzczzfzzizzkzzjzzizzhzzgzzfzzezzdzzczzbzzaz\ z`zz_zzZzzYzzXzzWzzVzzUzz } frm:MandAutoCritInZ {; Jim Muth a=real(p1), b=imag(p1), d=real(p2), f=imag(p2), g=1/f, h=1/d, j=1/(f-b), z=(((-a*b*g*h)^j)+(p4)), k=real(p3)+1, esc=imag(p3)+100, c=fn1(pixel): z=k*((a*(z^b))+(d*(z^f)))+c, |z| < esc } END PARAMETER FILE=========================================

1 0

Evilution
by JackOfTradeZ＠comcast.net 22 Feb '15

22 Feb '15

. See the Mandelbrot. See the Mandelbrot grow. Grow Mandelbrot Grow! . http://www.fractal-animation.net/vid/evolution.zip . 30MEG, 1min 48sec; 640WMV .

4 3

2 Pass Images - Zooms
by JackOfTradeZ＠comcast.net 22 Feb '15

22 Feb '15

. The 6 images are rendered at 1400x1050 ; took less time than I thought. http://www.fractal-animation.net/1400.zip .

2 1

2 Pass Images - Zooms
by JackOfTradeZ＠comcast.net 22 Feb '15

22 Feb '15

. I have begun rendering, at 1400 res ; gonna take awhile <G> . I will post them when done. Using the brand spiffy new FractInt version - see what it does. .

1 0

Two Pass Images - Zooms
by Niekamp 22 Feb '15

22 Feb '15

As promised here are some zooms. The Parent Image is slightly different, one inside frm has changed for better zooming spots. Save the complete par as 21587.par so that the frm is found instantly. Jack, maybe you can supply a zip with the completed images again for interested users and check if they generate corerectly ? Thank You! Albrecht ; Once again: If you´re unable to run DOS Fractint please use a bootstick or Dosbox. -----------------------------Start Par------------------------------------ 21587-11 { ; Crosswise ; Time 0.08.02.52 Reso 1280/1024 ; Mandel-Secant-ManyMods-Magnet-Newton ; Two pass image reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=cabs/cotan/acosh/sin passes=t center-mag=-0.49999977188738800/+0.13519979353864640/42374.71 params=-0.05825983458967864/0.3785210730307932/21587.6459576202/14523.49\ 11030602/152048.0404808041/384.16048940221/124.00482000595/128.100064300\ 1/256.1000323001/384.1000083001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000E1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>\ zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>11000011\ 0<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0\ DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0N } 21587-13 { ; Deep Mystery ; Time 0.07.13.44 Reso 1280/1024 ; Two Pass Image reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=cabs/cotan/acosh/sin passes=t center-mag=-0.50000000063898060/+0.13388606081312990/3.204528e+007/1/90/\ -1.23373533611470521e-014 params=-0.05825983458967864/0.3785210730307932/21587.6459576202/14523.49\ 11030602/152048.0404808041/384.16048940221/124.00482000595/128.100064300\ 1/256.1000323001/384.1000083001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000w0Jz0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>2202202\ 20<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<5>U07X08_09<\ 5>s0I } 21587-10 { ; ToyBot ; Time 0.07.13.44 Reso 1280/1024 ; Two Pass Image reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=exp/cabs/acosh/log passes=t center-mag=-0.50001495668490060/+0.13825321409216120/1023.972 params=-0.05825983458967864/0.3785210730307932/21587.6459576757/14523.49\ 11030602/152048.0404808041/384.16048940221/384.00482000595/128.100128300\ 1/256.1000243001/384.1000083001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 colors=000R0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kkammcpoe<3>zw\ m<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<\ 2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<7>V0D } 21587-08 { ; Mars Mission ; Time 0.07.13.44 Reso 1280/1024 ; Two Pass Image reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=cabs/cotan/acosh/sin passes=t center-mag=-0.50001495668490060/+0.13464526451612680/440.697 params=-0.05825983458967864/0.3785210730307932/21587.6459576202/14523.49\ 11030602/152048.0404808041/384.16048940221/124.00482000595/128.100064300\ 1/256.1000323001/384.1000083001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000E1R<3>7UX6`Z4h_2oa0wc<11>2TG2RE3OC<2>4G54D36F5<16>kkammcpoe<3>\ zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>11000011\ 0<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0\ DR0C<3>A08004000<26>000<4>000<9>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0N } 21587-05 { ; Games People Play ; Time 0.07.13.44 Reso 1280/1024 ; reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=cabs/cotan/acosh/sin passes=t center-mag=-0.50000076351673690/+0.13383343402715800/4406.97 params=-0.05825983458967864/0.3785210730307932/21587.6459576202/14523.49\ 11030602/152048.0404808041/384.16048940221/124.00482000595/128.100064300\ 1/256.1000323001/384.1000083001 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000E1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>\ zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>11000011\ 0<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0\ DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0N } 21587-02 { ; Parent Image ; Time 0.17.14.38 Reso 1280/1024 ; Mandel-Secant-ManyMods-Magnet-Newton reset=2004 type=formula formulafile=21587.par formulaname=mfr_14_2_21587 function=exp/cabs/acosh/log passes=t center-mag=-0.506604/-2.22045e-016/0.6881781/1/180 params=4.987654321987654/0/21587.64595767526/14523.4911030602/152048.040\ 4808001/384.16048940221/384.00482000595/128.1004240001/256.1007683001/38\ 4.20000800189 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 colors=000J57G46033923612301pUn<49>636535424<3>000VO2<15>970860650<3>110\ zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<38>AF09E08D0<3>5\ 80570450<3>010LKXEDM76BSQO<38>444333322<3>000pOa<5>735eFo<2>A3D } frm:mfr_14_2_21587 {; Albrecht Niekamp Feb.18,2015 - Phoenix update ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn1(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn3(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn4(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=sin(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ----------------------------End------------------------------------------

1 0

Re: [Fractint] Two Pass Procedure and image
by Hal Lane 22 Feb '15

22 Feb '15

Albrecht, Are you saying that (for a 2-pass image) after using: - PAR-1 and - mfr_14_1 to create the (still unfinished) image. - you save it as Image-1 Then you: - edit the PAR-1 and save it as: PAR-2, - edit mfr_14_2 and get: mfr_14_2_hand_modified, - have Image-1 available to be read in by Fractint, - Run PAR-2 and save the image as Image-2 Then, "Image-2" is the final result of the 2-pass mfr_14. Did I understand you correctly? - Hal Lane ######################## # hallane(a)earthlink.net ######################## ========================= Author: Niekamp Date: 2015-02-21 09:56 -500 To: fractint and General Fractals Discussion Subject: [Fractint] Two Pass Procedure and image After the first experimental version I have standardized the procedure. Written MFR_14 with two different versions, exclusively for two pass images. The first version has been stripped of all warp modifications and consequently function conflicts. It is down compatible and previous incompatible modifications are deleted. It is a lot faster and a good source for "from the scratch" creation. After generation a par must be copied into a special file for this image together with version two of MFR_14. The actual functions are copied into the frm, which is very easy as they all are close together. FN1-4 are now free again. Only thing more to do is modify the par to load the frm with the name of the image and set functions to "ident" and youÂ´re ready to go ahead with the modifications. 3 zooms are ready, possibly later. ; This is mainly for the records, the Fractint Archives, but possibly there is some reaction. The lurkers have ignored all requests for cooperation and feedback and no link will be supplied anymore. ; Here is version one of MFR_14, which may be useful for interested users and should be copied into the frm folder. Only the main loop is updated. ; ------------------------------------Start FRM-------------------------- mfr_14_1 {; Albrecht Niekamp Feb.19,2015 . . . ================================= --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

3 3

Thanks 4 the Brittle Star & what I call "Field of Sunflowers."
by Hal Lane 21 Feb '15

21 Feb '15

Mike, Thanks for the Brittle Star and what I call "Field of Sunflowers." - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Two Pass Procedure and image
by Niekamp 21 Feb '15

21 Feb '15

After the first experimental version I have standardized the procedure. Written MFR_14 with two different versions, exclusively for two pass images. The first version has been stripped of all warp modifications and consequently function conflicts. It is down compatible and previous incompatible modifications are deleted. It is a lot faster and a good source for "from the scratch" creation. After generation a par must be copied into a special file for this image together with version two of MFR_14. The actual functions are copied into the frm, which is very easy as they all are close together. FN1-4 are now free again. Only thing more to do is modify the par to load the frm with the name of the image and set functions to "ident" and you´re ready to go ahead with the modifications. 3 zooms are ready, possibly later. ; This is mainly for the records, the Fractint Archives, but possibly there is some reaction. The lurkers have ignored all requests for cooperation and feedback and no link will be supplied anymore. ; Here is version one of MFR_14, which may be useful for interested users and should be copied into the frm folder. Only the main loop is updated. ; ------------------------------------Start FRM-------------------------- mfr_14_1 {; Albrecht Niekamp Feb.19,2015 ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 u=1.0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9 c=px0 p=pp else if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9 c=px1 p=pp else c=px1 z=z cb=p9 endif else vb=v1m if (rs1) c=z z=pixel*(sc1+po1) z0=p7 ph=ph else c=z endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9 c=px2 p=pp else cb=p9 c=px2 endif else vb=v2m if (rs2) c=z z=pixel*(sc2+po2) z0=p7 else c=z endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9 c=px3 p=pp else cb=p9 c=px3 endif else vb=v3m if (rs3) c=z z=pixel*(sc3+po3) z0=p7 else c=z endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (d3) vb=v4j if (rs4) z=pixel cb=p9 c=px4 p=pp else cb=p9 c=px4 endif else vb=v4m if (rs4) c=z z=pixel*(sc4+po4) z0=p7 else c=z endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=fn2(z)*fn3(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn2(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=fn3(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } -----------------------------------------End FRM--------------------------- ; -----------------------------------------Start Par------------------------- 21547-11 { ; Parent View ; Mandel-Secant-ManyMods-Manowar-Newton ; Time 0.15.58.94 Reso 1280/1024 ; Two Pass Fractal - Second Pass Modifications reset=2004 type=formula formulafile=21547.par formulaname=mfr_14_2_21547 function=exp/cabs/acosh/zero passes=t center-mag=-0.497889/-1.33227e-015/0.6963012 params=-0.05825983458967864/0.3785210730307932/21547.64595767526/14523.4\ 911030602/152048.0404808041/384.16048940221/384.00482000595/128.10076830\ 01/256.1007683001/384.20000800189 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } frm:mfr_14_2_21547 {; Albrecht Niekamp Feb.18,2015 - Phoenix update ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn1(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn3(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn4(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=sin(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } ---------------------------------------------End-------------------------------

1 0

Brittle Star
by Mike Frazier 20 Feb '15

20 Feb '15

I like this fractal because it has thin intricate arms. Zooming into different minbrots in the area yields lots of variations in the structure of the arms. The formula is a two term parallel resistor type and mixes sinh and z: z=1/(1/(-1 * z^4 * sinh(z) + pixel + 1) + 1/(-1 * z^5 + pixel - 1)) The equation was constructed so that the minimum power of z representing the series for each term is 5. All the minibrots in the fractal are order 5. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/brittle_star_1200_5.jpg The FractInt compatible PAR file for the image is: Brittle_Star { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150219_1752 passes=1 float=y center-mag=-2.618024534705701/-4.588792567258185e-\ 13/45812985152.63476/1/0/0 params=-1/-1/5/5/-1/0/1/0/1/0 maxiter=2000 inside=0 periodicity=6 colors=000000C10C10O40O40ZA0ZA0hI0hI0oS0oS0ua0ua0y\ m0PE1TJ5YOAbTEgXIkaMpfRukVzp_wH0fG0DLW9Njkmlggcb`U\ WTISM8MF0RM8YVMdd_ikiggc`ZRWTIQK5MF0RM8YVMdd_ikigg\ c`ZRWTIQK5MF0RM8YVMdd_ikiggc`ZRWTIQK5MF0RM8YVMdd_i\ kiggc`ZRWTIQK5MF0RM8YVMdd_ikiggc`ZRWTIQK5MF0RM8YVM\ dd_ikiggc`ZRWTIQK5MF0RM8YVMdd_ikiggc`ZRWTIQK5MF0RM\ 8YVMdd_ikiggc`ZRWTIQK5MF0RM8YVMdd_ikiggc`ZRWTIQK5M\ F0RM8YVMdd_ikiggc`ZRWTIQK5MF0RM8YVMdd_ikiggc`ZRWTI\ QK5MF0RM8YVMdd_ikiggc`ZRWTIQK5kmlkmlkmlkmlkmlkmlkm\ ljkijkijkijkijkijkijkihifhifhifhifhifhifhifggcggcg\ gcggcggcggcggcee`ee`ee`ee`ee`ee`dbXdbXdbXdbXdbXdbX\ dbXb`Ub`Ub`Ub`Ub`Ub`Ub`U`ZR`ZR`ZR`ZR`ZR`ZR`ZR_XO_X\ O_XO_XO_XO_XOYVLYVLYVLYVLYVLYVLYVLWTIWTIWTIWTIWTIW\ TIWTIVQEVQEVQEVQEVQEVQEVQETOBTOBTOBTOBTOBTOBSM8SM8\ SM8SM8SM8SM8SM8QK5QK5QK5QK5QK5QK5QK5OI2OI2OI2OI2OI\ 2OI2OI2MF0MF0MF0MF0MF0MF0 } frm:F_20150219_1752 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2)-1,d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(z^b)*sinh(z*p5)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

First Two Pass Image
by Niekamp 19 Feb '15

19 Feb '15

Trying to find a way to solve the lack of functions problem I used a 2 pass generation. The first pass for the basic image and the other one for the modifications only. Therefore the FRM variation is an integrated part of the Parfile. ; Albrecht ; ----------------------------Start Par------------------------------------- 35080-13 { ; Two Pass Image ; The first in Fractint History ; Time 0.12.12.32 Reso 1280/1024 ; First Pass-Basic Image, 2nd Pass-Modifications reset=2004 type=formula formulafile=35080-01.par formulaname=mfr_13_35080 function=sqrt/sinh/sin/sqrt passes=t center-mag=-46.1752/-3.31949/29.48356/1/174.999999999952564/8.9730195496\ 0738612e-011 params=-0.05825983458967864/0.3785210730307932/35080.6459011707/45235.49\ 11030602/152048.0404808048/24.1604894048/4.00482000595/128.10000323001/4\ 22.2000003001/768.1000003001 float=y maxiter=3071 inside=maxiter periodicity=0 rseed=-2436 colors=000535<3>111000VO2<15>970860650<3>110zh3<35>A70860750<3>110wON<3>\ _EDUCBO99<2>622DL6<2>351gy2<44>580570450<3>010LKXEDM76BSQO<38>433333322<\ 3>000pOa<3>MAGF6A735eFo<2>A3DJ57<3>612301pUn<49>636 } frm:mfr_13_35080 {; Albrecht Niekamp Feb.18,2015 ;P1 : Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods, fn3_Bees, fn2+fn3+fn4(virtual P1)_Lambda(fn) z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) u0=fn1(t*sfac) if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) u=fn3(t*fac2) else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=exp(z)*sin(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=sin(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=sin(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } -----------------------------------End-----------------------------------

1 0

Off Axis
by Mike Frazier 16 Feb '15

16 Feb '15

I usually search along the x axis for most of my fractals. I like symmetrical fractals and you always find symmetrical fractals there. This fractal is not on the x axis and has an unusual appearance. Zooming into the chaotic area near the center will reveal minibrots surrounded with more and more complex features the deeper you zoom. The formula is a two term parallel resistor type and mixes sinh and z: z=1/(1/(z^5 * sinh(z) + pixel + 1) + 1/(z^6 + pixel - 1)) The equation was constructed so that the minimum power of z representing the series for each term is 6. Thats the reason for the extra z^5 in front of the sinh. All the minibrots in the fractal are order 6. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/off_axis_1200_5.jpg The FractInt compatible PAR file for the image is: Off_Axis { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150215_1610 passes=1 float=y center-mag=0.2097030402788148/1.397964423444541/34\ 063.89038708725/1/0/0 params=1/1/6/6/-1/0/1/0/0/0 maxiter=2000 inside=0 periodicity=6 colors=0000000000000000000000000000000000000000000\ 00000000000000AFAAKAAMDANGAPIARLBTOBVRBXUBZXCabCce\ CehCgkCinCkqDlsCkqCinCgkCceCabB`_BZXBXUBVRBTOARLAP\ I1NE1QF2WH2`I2cJ3iL4nM4qN5vPzy0zy0zy0ym0ym0ua0ua0o\ S0oS0hI0hI0ZA0ZA0ZA0O40O40C10C10000000C10C10O40O40\ O40ZA0ZA0hI0hI0oS0oS0ua0ua0ym0ym0ym0zy0zy0ym0ym0ua\ 0ua0oS0oS0hI0hI0hI0ZA0ZA0O40O40C10C10000000C10C10C\ 10O40O40ZA0ZA0hI0hI0oS0oS0ua0ua0ua0ym0ym0zy0zy0ym0\ ym0ua0ua0oS0oS0oS0hI0hI0ZA0ZA0O40O40C10C1000000000\ 0C10C10O40O40ZA0ZA0hI0hI0oS0oS0oS0ua0ua0ym0ym0zy0z\ y0ym0ym0ua0ua0ua0oS0oS0hI0hI0ZA0ZA0O40O40C10C10AKA\ AKAAKAAKADMDDMDDMDFPGFPGFPGFPGIRJIRJIRJLTMLTMLTMLT\ MNWPNWPNWPQYSQYSQYST`VT`VT`VT`VWbYWbYWbYYe`Ye`Ye`Y\ e``gc`gc`gccjfcjfcjfelielielieliholholholkqokqokqo\ kqomsqmsqmsqkqokqokqokqoholholholelielielicjfcjfcj\ fcjf`gc`gc`gcYe`Ye`Ye`Ye` } frm:F_20150215_1610 { ; Similar to the parallel resistance formula a=real(p1),b=real(p2)-1,d=imag(p1),f=imag(p2), z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/(a*(z^b)*sinh(z)+c1)+1/(d*(z^f)+c2)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

Galapagos
by Niekamp 15 Feb '15

15 Feb '15

There are so many zooming spots in yesterday´s image I dont know where to start, so I just take the one I like best ; https://www.dropbox.com/sh/eroo27cx7ok47as/AAAx0RlQShQI5QK7DPe6msHWa?dl=0 ; Albrecht ; ---------------------------------------Start Par------------------------- 60008-23 { ; Galapagos ; Phoenix-Lambda ; Time 0.03.41.35 Reso 1280/1024 ; Increased Lambda Complexity - SG Colormap reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/cotanh/acosh/atanh passes=t center-mag=+0.55345571847507260/-0.18480607374511330/3089.899/1/-72.4999\ 999999938183/-7.40394551224099473e-012 params=0.5267637918811443/-0.1364881926697067/60008.07000100007/11112.05\ 06030602/151024.0087208192/14.32768524288/384.00482000595/256.1007683/51\ 2.1007683001/768.3000010082312 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000`D8cG6fI4iL2kO1<2>sY0u`0vc2xf3yi5zk7<2>zsHzuKyvOxxSwyWuz_tzcrz\ fozj<2>gxsdwuauwZty<2>QmzNjzKgyHdxEav<2>7Tn5Qk4Nh2Kd1H`<3>07M05I14E22B31\ 8506704902B01<2>J20M30P52S73V95YB7aEA<3>lPOoSSqVW<2>wdfxgjyimzlp<2>zswzu\ yywzxxzwyzuzzszyqzxozv<2>gxndwkauhYsdVq`<3>JgMGdIEaEBYB<2>5P43M22J11G00E\ 00B009007205313522741A50D<3>E0SH1WK2_<2>T7jW9mZCp<2>gKwjNymQzoTzrWztZzua\ ywdxxgvyjt<2>zrkzthzud<2>vyTuzPszMpzInzEkzB<2>cv4`u2Ys1<3>Li0<2>D`5AY78V\ A6RD<3>1GS0DW0A_<2>04j13m32p41s<2>A0yC0zF0zI1zL3zO4yR6xU8vXAt<3>hLhkOdmR\ `<2>t_PvbMweIxhEykB<2>zr4zt2yv1<3>tz0<2>mz5ky7hxAewD<2>XrOUpSRmW<3>FbjC_\ mAXp<2>4Ow3Ly1Iz0Fz0Cz0Az08y06x14v23t31q<2>80hA0dD0`<3>O4MR6IV8EYAB } ----------------------------------------End--------------------------------

1 0

FOTY
by Niekamp 14 Feb '15

14 Feb '15

Phoenix-Lambda ; https://www.dropbox.com/sh/4mh7bz4h3vpc2vq/AABkrnqE0vK04Jz8_PnT7ns8a?dl=0 ; Albrecht ; ----------------------------------Start Par------------------------------ 60008-13 { ; FOTY ; Phoenix-Lambda ; Time 0.01.10.69 Reso 1280/1024 ; SG ColorMap compressed reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/cotanh/acosh/atanh passes=t center-mag=-3.33067e-016/-3.33067e-016/0.8503401/1/-90/3.885780586188047\ 89e-016 params=0.5267637918811443/-0.1364881926697067/60008.07000100007/11112.05\ 06030602/151024.0008808192/14.32768524288/384.00482000595/256.1007683/51\ 2.1007683001/768.3000180082312 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000YsdVq`<3>JgMGdIEaEBYB<2>5P43M22J11G00E00B009007205313522741A50\ D<3>E0SH1WK2_<2>T7jW9mZCp<2>gKwjNymQzoTzrWztZzuaywdxxgvyjt<2>zrkzthzud<2\ >vyTuzPszMpzInzEkzB<2>cv4`u2Ys1<3>Li0<2>D`5AY78VA6RD<3>1GS0DW0A_<2>04j13\ m32p41s<2>A0yC0zF0zI1zL3zO4yR6xU8vXAt<3>hLhkOdmR`<2>t_PvbMweIxhEykB<2>zr\ 4zt2yv1<3>tz0<2>mz5ky7hxAewD<2>XrOUpSRmW<3>FbjC_mAXp<2>4Ow3Ly1Iz0Fz0Cz0A\ z08y06x14v23t31q<2>80hA0dD0`<3>O4MR6IV8EYAB<2>fI4iL2kO1<2>sY0u`0vc2xf3yi\ 5zk7<2>zsHzuKyvOxxSwyWuz_tzcrzfozj<2>gxsdwuauwZty<2>QmzNjzKgyHdxEav<2>7T\ n5Qk4Nh2Kd1H`<3>07M05I14E22B318506704902B01<2>J20M30P52S73V95YB7aEA<3>lP\ OoSSqVW<2>wdfxgjyimzlp<2>zswzuyywzxxzwyzuzzszyqzxozv<2>gxndwkauh } ---------------------------------End---------------------------------------

1 0

New Phoenix
by Niekamp 14 Feb '15

14 Feb '15

Phoenix Time! There is a tiny update, back compatible as always. If the input is zero it uses P1 like Magnet and Lambda. It has gained much complexity and is fast enough, only some seconds, for the "Monkey" game. Every value after the P1 dots will supply an image - so like Magnet - special sequences will get special results. In the featured image I used "contra pointed" values which has the effect that there is no similarity between left and right. Phoenix however uses the same shape for both parts. Watch and dig it. In the folder find the new input table and the frm for copying. ; https://www.dropbox.com/sh/0u9q3jyy51a0zvd/AABckq36Crh-P8h9MRthdccka?dl=0 ; Albrecht ; -------------------------------Start Par--------------------------------- 60000-10 { ; New Phoenix ; Parent Image (one of many) ; Time 0.00.52.72 Reso 1280/1024 ; Needs the latest update - P1 Input reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/exp/exp/sin passes=t center-mag=0.251571/0.00268067/0.7526882/1/-95/-3.77822773067748585e-014 params=1.918273645546373/4.192837465564739/60000.07005700001/11111.05060\ 30602/151024.0204808192/14.32768524288/384.00482000595/256.1007683/512.1\ 007683001/768.2007680082311 float=y maxiter=1024 inside=maxiter periodicity=0 rseed=-2436 colors=000B90<3>550340230020010uON<3>YEDSCBM99<2>422BL6<2>151ey2<42>5A04\ 90380<3>030020010JKXCDM56BQQO<37>244233133<3>011000nOa<3>KAGD6A535cFo<2>\ 83DH57<3>412101nUn<48>547436335224123<2>000TO2<15>770660450340230020010x\ h3<32>CA0 } frm:multifractal_13 {; Albrecht Niekamp Feb.13,2015 - Phoenix update ;P1 Julia-Manowar-(Lambda)-(Magnet)-(Phoenix) seed ;RP2 Left: 5 Digit_Channels: (1)shape (2)out (3)ins_1 (4)ins_2 (5)ins_3 ; Frm: 0_off 1_Secant 2_Mand(2) 3_Bees 4_Jul/Manowar 5_Mmods ; 6_Phoenix 7_Newton 8_Lambda/Magnet ; Right: 2 Digit_ManyMods_Number of sides 2 Digit_Phoen 2 Digit_Lambd ; 1 Digit_TransReset-Shape: 0_no 1_DblMan 2_Iter 3_both +5_nowarp ; 4 Digit_TransReset-Ch 2-5: 0_no 1_z 2_Iter 3_both +5_warp ;IP2 Left: 5 Digit_Bailout Number for Channels 1 to 5 ; Right: Variables: 4 Digit_Mand/Jul (2var) 2 Digit_Secant 4 Digit_Bees ;RP3 Left: 2 Digit_Newtonvariable 4 Digits_bailout1 ; Right: 4 Digit_bailout2 4 Digit_bailout3 1 Digit_Magnet ;IP3 Left: 4 Digit_Shape: Warp-factor (fn1 or fn4 is used) ; Right: 4 Digit_bailout4 4 Digit_bailout5 1 digit_mow=2 1 digit_mag=2 ;RP4 Left: 4 Digit_Outside: Warp-factor (fn2 used) ; Right: Outside: 4 Digit+fractdig_Border-out 4 Digit+fractdig_border-in ;IP4 Left: Inside1_Maxiter ; Right: Inside1_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn2 used) 4 Digit+fractaldigit_border1 ;RP5 Left: Inside2_Maxiter ; Right: Inside2_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digit_warp factor (fn3 used) 4 Digit+fractaldigit_border2 ;IP5 Left: Inside3_Maxiter ; Right: Inside3_Transit: 1_maxit 2_borderout 3_borderin +5_maxit+bord ; 5 Digits_Warp factor (fn4 used) 4 Digit+fractaldigit_border3 ;Function: fn1_Manymods fn3_Bees fn2+fn3_Lambda z=pixel da=real(p2) dd=trunc(da) tt=dd>0 da=trunc(((da-dd)*100000000000)+11111) dd=trunc(dd+11111) d=trunc(dd/10000) dd=dd-d*10000 d3=(d==4)+(d==5)+(d==8)+(d==9) d4=d3==0 vb=d>5 ex0=(d>1) sc=d==2 bs=d==4 mo=d==6 po=d==7 sx=d==9 ab=po+(d==3)+(d==5)+(d==9) d=trunc(dd/1000) dd=dd-d*1000 ex1=(d>1) sc1=d==2 bs1=d==4 mo1=d==6 po1=d==7 sx1=d==9 v1m=mo1+po1 v1j=d>7 dd1=v1j+(d==4)+(d==5) ab1=po1+(d==3)+(d==5)+(d==9) d=trunc(dd/100) dd=dd-d*100 ex2=(d>1) sc2=d==2 bs2=d==4 mo2=d==6 po2=d==7 sx2=d==9 v2m=mo2+po2 v2j=d>7 dd2=v2j+(d==4)+(d==5) ab2=po2+(d==3)+(d==5)+(d==9) d=trunc(dd/10) dd=dd-d*10 ex3=(d>1) sc3=d==2 bs3=d==4 mo3=d==6 po3=d==7 sx3=d==9 v3m=mo3+po3 v3j=d>7 dd3=v3j+(d==4)+(d==5) ab3=po3+(d==3)+(d==5)+(d==9) d=dd ex4=(d>1) sc4=d==2 bs4=d==4 mo4=d==6 po4=d==7 sx4=d==9 v4m=mo4+po4 v4j=d>7 dd4=v4j+(d==4)+(d==5) ab4=po4+(d==3)+(d==5)+(d==9) bst=bs+bs1+bs2+bs3+bs4 mot=mo+mo1+mo2+mo3+mo4 tt=ex1+ex0+ex2+ex3+ex4 ; mm=trunc(da/1000000000) da=da-mm*1000000000 ph=trunc(da/10000000) da=da-ph*10000000 sp=trunc(da/100000) da=da-sp*100000 d=trunc(da/10000) da=da-d*10000 wx=(d>4) d=d-5*wx dm=(d==2)+(d==4) ir0=(d==3)+(d==4) d=trunc(da/1000) da=da-d*1000 w1=d>4 d=d-5*w1 rs1=(d==2)+(d==4) ir1=(d==3)+(d==4) d=trunc(da/100) da=da-d*100 w2=d>4 d=d-5*w2 rs2=(d==2)+(d==4) ir2=(d==3)+(d==4) d=trunc(da/10) da=da-d*10 w3=d>4 d=d-5*w3 rs3=(d==2)+(d==4) ir3=(d==3)+(d==4) w4=da>4 da=da-5*w4 rs4=(da==2)+(da==3)+(da==4) if (ph==0) ph=p1 else ph=ph/10 endif w0=(wx==0) If (1<sp) d=(trunc(sp/10))/9 da=fn4(sp-100*d) d=sp/73,37 sp=d+sqr(-da) else sp=p1 endif ; d=real(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) pp=trunc(dd/10000) ba1=dd-10000*pp ba2=trunc(da/1000000) da=da-1000000*ba2 ba3=trunc(da/100) da=da-100*ba3-4 mg=da/10 if (mg<1) mg=real(p1) endif ; d=imag(p3) dd=trunc(d) da=trunc((d-dd)*10000000000) sfac=dd/1000000+(dd==0) ba4=trunc(da/1000000) da=da-ba4*1000000 ba5=trunc(da/100) da=da-ba5*100 d=trunc(da/10) da=da-d*10 mow=d==2 mag=da==2 px0=((sx*mag)==0)*p1 px1=((sx1*mag)==0)*p1 px2=((sx2*mag)==0)*p1 px3=((sx3*mag)==0)*p1 px4=((sx4*mag)==0)*p1 ; d=real(p4) dd=trunc(d) da=trunc((d-dd)*10000000000) ofac=dd/1000000+(dd==0) bh=trunc(da/100000)/10 bl=(da-bh*1000000)/10 bs=bl/2 ; d=imag(p2) dd=trunc(d) da=trunc((d-dd)*10000000000) d=trunc(dd/10000) dd=dd-d*10000 bb0=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/1000) dd=dd-d*1000 bb1=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/100) dd=dd-d*100 bb2=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=trunc(dd/10) dd=dd-d*10 bb3=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) d=dd bb4=ba1*(d==1)+ba2*(d==2)+ba3*(d==3)+ba4*(d==4)+ba5*(d==5) ; d=da p0=trunc(d/100000000)/10 d=d-p0*1000000000 p6=trunc(d/1000000)/10 d=d-p6*10000000 p7=trunc(d/10000)/10 d=d-p7*100000 dp=p6+p0/100 p8=trunc(d/100)/100 d=d-p8*10000 p9=d/100 ; d=imag(p4) mi1=trunc(d) da=trunc((d-mi1)*100000000000) d=trunc(da/10000000000) bt1=d>6 da=da-d*10000000000 d=d-5*bt1 dt1=d>1 iv1=d==3 dd=trunc(da/100000) da=da-dd*100000 fac1=dd/1000000+(dd==0) bo1=(da/100000)/10 ; d=real(p5) mi2=trunc(d) da=trunc((d-mi2)*100000000000) d=trunc(da/10000000000) bt2=d>6 da=da-d*10000000000 d=d-5*bt2 dt2=d>1 iv2=d==3 dd=trunc(da/100000) da=da-dd*100000 fac2=dd/1000000+(dd==0) bo2=(da/100000)/10 ; d=imag(p5) mi3=trunc(d) da=trunc((d-mi3)*100000000000) d=trunc(da/10000000000) bt3=d>6 da=da-d*10000000000 d=d-5*bt3 dt3=d>1 iv3=(d==3) dd=trunc(da/100000) da=da-dd*100000 fac3=dd/1000000+(dd==0) bo3=(da/100000)/10 ; if (vb) if (d3) if (ab) if (mag) c=z z=pixel x=mg x=x+(x==0)*3 ;magnet else z=pixel ;lambdafn x=((1,0.4)*(|sp|<=0)+sp) m=(64*(real(bb0)<=0)+real(bb0)*(0<bb0)) endif else c=z z=pixel ;newton endif elseif (ab) c=z ;Phoenix z=pixel else c=0.4*log(sqr(z^mm)) z=0 ;many mods endif elseif (d3) if (ab) if (mow) ;manowar mt=(4*(real(p2)<=0)+real(p2)*(0<p2) ) c=p1 z=pixel else c=p1 ;Julia z=pixel endif else ;bees c=p1 z=pixel endif elseif (ab) c=z ;Mandel z=0 else c=z ;Secant z=pixel endif t=0 bo=|z| p=pp z0=p7 zold=(0.0,0.0) cb=p9 ba=bb0 : if (tt>0) t=t+1 if (ex0) ex0=t<mi1 if (bo>bs) if (mot) u0=fn4(t*sfac) else u0=fn1(t*sfac) endif if (w0) u=u0 else u=1.0 endif ex0=0 if (ir0) t=0 endif if (d3) z=pixel cb=p9*u c=px0*u p=pp*u x=x*u else z=z*u if (mo) c=0.4*log(sqr(z^mm)) else c=pixel endif tt=tt-1+ex0 endif endif elseif ((ex1)&&bo>bl) if (bo<bh) d3=dd1 ba=bb1 ab=ab1 ex1=0 tt=tt-1 if (w1) u=fn2(t*ofac) else u=1.0 endif if (ir1) t=0 endif if (d3) vb=v1j if (rs1) z=pixel cb=p9*u c=px1*u p=pp*u x=x*u else c=px1 z=z*u cb=p9 endif else vb=v1m if (rs1) c=z*u z=pixel*(sc1+po1) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo1) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex2) if (dt1) if (iv1) d=bo>bo1 else d=bo<bo1 endif if (bt1) d=d+(t>mi1) endif else d=t>mi1 endif if (d) ab=ab2 d3=dd2 ba=bb2 ex2=0 tt=tt-1 if (w2) u=fn2(t*fac1) else u=1.0 endif if (ir2) t=0 endif if (d3) vb=v2j if (rs2) z=pixel cb=p9*u c=px2*u p=pp*u x=x*u else cb=p9 c=px2 z=z*u endif else vb=v2m if (rs2) c=z*u z=pixel*(sc2+po2) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo2) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex3) if (dt2) if (iv2) d=bo>bo2 else d=bo<bo2 endif if (bt2) d=d+(t>mi2) endif else d=t>mi2 endif if (d) ab=ab3 d3=dd3 ba=bb3 ex3=0 tt=tt-1 if (w3) If (bst) u=fn2(t*fac2) else u=fn3(t*fac2) endif else u=1.0 endif if (ir3) t=0 endif if (d3) vb=v3j if (rs3) z=pixel cb=p9*u c=px3*u p=pp*u x=x*u else cb=p9 c=px3 z=z*u endif else vb=v3m if (rs3) c=z*u z=pixel*(sc3+po3) z0=p7*u ph=ph*u else c=z z=z*u endif vb=v3m if (mo3) c=0.4*log(sqr(z^mm)) endif endif endif elseif (ex4) if (dt3) if (iv3) d=bo>bo3 else d=bo<bo3 endif if (bt3) d=d+(t>mi3) endif else d=t>mi3 endif if (d) ab=ab4 d3=dd4 ba=bb4 ex4=0 tt=0 if (w4) u=fn4(t*fac3) else u=1.0 endif if (d3) vb=v4j if (rs4) z=pixel cb=p9*u c=px4*u p=pp*u x=x*u else cb=p9 c=px4 z=z*u endif else vb=v4m if (rs4) c=z*u z=pixel*(sc4+po4) z0=p7*u ph=ph*u else c=z z=z*u endif if (mo4) c=0.4*log(sqr(z^mm)) endif endif endif endif endif if (vb) if (d3) if (ab) if (mag) ;magnet z=((z^x+c-1)/(2*z+c-2))^(x-1) else z=fn2(z)*fn3(x) ;Lambdafn abs(imag(z))<=x && abs(real(z))<=m endif else z1=z^p-1 ;newton z2=p*z*z z=z-z1/z2 endif elseif (ab) z1=z*z+0.56+ph/100-0.5*zold zold=z ;Phoenix z=z1 else z2=fn1(z)+c ;Many_mods z1=cos(z2) z=c*(1-z1)/(1+z1) endif elseif (d3) if (ab) if (mow) z1=z ;manowar oldz=z z=sqr(oldz)+z1+c z1=oldz else ;Julia z=z2*z2+p6*z2+c-p0 endif else z1=fn3(z)-cb ;Bees z2=z1^p8-1 z3=p8*(z1^(p8-1)) z=z-(z2/z3) endif elseif (ab) if (dm) z=z*z+c+c*c-dp ;Double Mandel else z2=z*z ;Mandel z=z2*z2+p6*z2+c-p0 endif else z3=z ;Secant z1=z0*z0*z0*z0-1 z2=z*z*z*z-1 z=z-z2*(z-z0)/(z2-z1) z0=z3 endif bo=|z| bo<ba } --------------------------------------End----------------------

1 0

Fractint under VMware XP32 - David W. Riccio
by Albrecht Niekamp 13 Feb '15

13 Feb '15

Maybe you can help being an expert on the subject. XP32 VM new installed with Win7 host and works perfectly, even networking. Fractint is on a bootstick which is accessable for file management. How can I start Fractint, apparently it is unable to use network addresses ? Tried several sstools settings but no luck. For XP I use 1280/1024 reso with software speed up, so it should be available as vesa mode ? Thanks for any help. Albrecht

1 0

latest images
by JackOfTradeZ＠comcast.net 13 Feb '15

13 Feb '15

. the next batch of zooms from Albrecht are posted: http://www.fractal-animation.net/2_13_2015.zip 9 files, about 1.5MEG . Why use the tessie method for rendering? It is slower and actually less accurate than the passes=g option! Essentially, it sucks. The only redeeming quality is that it looks cool when working; I actually used it in an animation some years ago. I always use passes=1. If your gonna do something do it right. Slower, but most accurate. And these complex fractal formula have so much intricate detail that is otherwise lost. . Enjoy! JoTz .

2 1

Bees-Newton Variations
by Niekamp 11 Feb '15

11 Feb '15

Here are the zooms into the "Chaos" image, which is not chaotic after all. Although some elements of the Bees frm remain dominant it has become an interesting collection. ; https://www.dropbox.com/sh/v1gn11kc4rm4vcl/AAD93XXKWBUmQIDIEuVSKPj-a?dl=0 ; Albrecht ; -----------------------------------------Start par----------------------- 30007-08 { ; Into Chaos Zoom1 ; Bees-Newton ; Time 0.01.25.90 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=1.68204/4.44089e-016/0.6666667/1/90/-1.23373533611470521e-014 params=4.123456789123456/0.1/30007.32595750001/10004.0506031804/452048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 512.2002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000735eFo<2>A3DJ57<3>612301pUn<49>636535424<3>000VO2<15>970860650\ <3>110zh3<35>A70860750<3>110wON<3>_EDUCBO99<2>622DL6<2>351gy2<44>5805704\ 50<3>010LKXEDM76BSQO<38>433333322<3>000pOa<4>F6A } 37000-02 { ; Into Chaos Zoom2 ; Bees-Newton ; Time 0.05.54.06 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.00283917045649553/+0.24497451479965260/59335.44/1/-143.999\ 999999950148/-3.78354916841239231e-011 params=4.123456789123456/0.1/37000.32595756001/54004.0506031804/432048.0\ 404808/33.16048940221/214.3432700812/256.1/512.1/64.2 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=0007B0<21>MO4NO4OP5<5>RS7RT7ST8<3>TWATWAUXA<8>U`FUaFUaG<3>TcIScJS\ cJ<5>PfMOfNOfO<5>KhRJhRIhSHhSHiTGiT<7>AiX9iY9jY<8>3ia3ia2ib<3>1hc1hc0hd<\ 9>0ef0df0df<7>3ag3`g4`g5_g<8>AWfBVfCVfDUfDUf<9>LOcLNcMNcNMbNMbOLb<4>RI`R\ I_SH_<3>TFYTEYUEX<8>U9TU9SU8S<4>S6PS6PS5O<3>Q4MP4LP3L<4>L2IL2IK1H<11>B0B\ A0AA0A90A<7>406306305305<3>114113013<9>041051050<4>270270280<6>6B0 } 37000-07 { ; Into Chaos Zoom3 ; Bees-Newton ; Time 0.07.38.30 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.00283119552387885/+0.24498521526874660/2.897021e+010/1/-14\ 2.999982069365245/-2.09290520727586915e-005 params=4.123456789123456/0.1/37000.32595756001/54004.0506031804/432048.0\ 404808/33.16048940221/214.3432700812/256.1/512.1/64.2 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000ETe<8>LOcLNcMNcNMbNMbOLb<4>RI`RI_SH_<3>TFYTEYUEX<8>U9TU9SU8S<3\ >T7QS6PS6P<3>Q4MF4MP4LP3LO3K73KN2J<15>B0BA0AA0A90A<7>406306305305<3>1141\ 13013<9>041051050<4>270270280<3>4905A05A0<23>MO4NO4OP5<5>RS7RT7ST8<3>TWA\ TWAUXA<8>U`FUaFUaG<3>TcIScJScJ<5>PfMOfNOfO<5>KhRJhRIhSHhSHiTGiT<7>AiX9iY\ 9jY<8>3ia3ia2ib<3>1hc1hc0hd<9>0ef0df0df<7>3ag3`g4`g5_g<8>AWfBVfCVfDUfDUf } 30007n01 { ; Into Chaos Zoom4 ; Bees-Newton ; Time 0.01.41.88 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=-0.841642/0/0.6666667/1/90/3.88578058618804789e-016 params=4.123456789123456/0.1/30007.325957/10004.0506031804/152048.040480\ 8001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/512.2\ 002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7U\ X6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>\ VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjg\ RmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<3\ 0>000 } 30007n05 { ; Into Chaos Zoom5 ; Bees-Newton ; Time 0.17.09.80 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=-0.91274319771889980/+0.00493026947375868/19856.4/1/86.999999\ 99999811/9.92719795256391535e-013 params=4.123456789123456/0.1/30007.32595750011/21112.0506031804/122048.0\ 404808001/0.16048940221/0.3132705812239/256.100000595/512.1000003001/24.\ 2000000021999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000<20>000000000<3>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K\ 0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zw\ m<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<\ 2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR\ 0C<3>A08004000<4>000 } 30007n18 { ; Gyroscope ; Bees-Newton ; Time 0.05.47.04 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.20114258384498080/-0.31346236430197790/5246.909/1/65.00000\ 00000075886/-4.59233345795340142e-012 params=4.123456789123456/0.1/37000.32595756001/54004.0506031804/432048.0\ 404808/33.16048940221/214.3432700812/256.100002595/512.1007683001/64.200\ 0000004998 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000X08<3>i0D005p0G<2>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q\ 0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>\ 2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<4\ 3>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFR\ KDOGA<3>A00<5>U07 } 37000n04 { ; BunnyBee ; Bees-Newton ; Time 0.02.03.06 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.00283148281030230/+0.24498485073146850/2.373418e+007/1/-14\ 3.000000004507314/1.01703999388913502e-009 params=4.123456789123456/0.1/37000.32595756001/54004.0506031804/432048.0\ 404808/33.16048940221/214.3432700812/256.1/512.1/64.2 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000IK2<5>MO4NO4OP5<5>RS7RT7ST8<3>TWATWAUXA<8>U`FUaFUaG<3>TcIScJSc\ J<5>PfMOfNOfO<5>KhRJhRIhSHhSHiTGiT<7>AiX9iY9jY<8>3ia3ia2ib<3>1hc1hc0hd<9\ >0ef0df0df<7>3ag3`g4`g5_g<8>AWfBVfCVfDUfDUf<9>LOcLNcMNcNMbNMbOLb<4>RI`RI\ _SH_<3>TFYTEYUEX<8>U9TU9SU8S<4>S6PS6PS5O<3>Q4MP4LP3L<4>L2IL2IK1H<11>B0BA\ 0AA0A90A<7>406306305305<3>114113013<9>041051050<4>270270280<3>4905A05A0<\ 16>HK2 } 37000n05 { ; Happy Easter ; Bees-Newton ; Time 0.05.46.36 Reso 1280/1024 ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.00283119568968685/+0.24498521505465980/2.897021e+009/1/-14\ 1.999999368441109/-4.49821391940163906e-008 params=4.123456789123456/0.1/37000.32595756001/54004.0506031804/432048.0\ 404808/33.16048940221/214.3432700812/256.1/512.1/64.2 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000IhS<10>AiX9iY9jY<8>3ia3ia2ib<3>1hc1hc0hd<9>0ef0df0df<7>3ag3`g4\ `g5_g<8>AWfBVfCVfDUfDUf<9>LOcLNcMNcNMbNMbOLb<4>RI`RI_SH_<3>TFYTEYUEX<8>U\ 9TU9SU8S<4>S6PS6PS5O<3>Q4MP4LP3L<4>L2IL2IK1H<11>B0BA0AA0A90A<7>406306305\ 305<3>114113013<9>041051050<4>270270280<3>4905A05A0<23>MO4NO4OP5<5>RS7RT\ 7ST8<3>TWATWAUXA<8>U`FUaFUaG<3>TcIScJScJ<5>PfMOfNOfO<6>JhR } ----------------------------------------------End---------------------------

1 0

latest pix
by JackOfTradeZ＠comcast.net 11 Feb '15

11 Feb '15

. the most recent PAR posts from Albrecht, etc. are rendered at 1024, total of 11, file about 2 MEG http://www.fractal-animation.net/2_10_15.zip .

2 1

Into Chaos
by Niekamp 09 Feb '15

09 Feb '15

This is the last "mate" for the Bees. But today it´s not a mate bcause they are incompatible, mostly the Newton part is completely invisible. In such a case I use my Border System - never have tried to explain it sofar. It means that predefined "z" values are used for a certain channel.It can be done for each of the 5 channels separately as usual and can be used in two directions - up or down (backwards). If that is done with the outside channel it is actually placed inside - that´s what I have done today. Sounds complicated? It is- to set up and to calculate. Using the ultra fast pure dos bootstick more then half an hour, means several hours with XP Dos. Not a pretty image but interesting indeed. To get some more clarity I compressed the Newton part. Zooms maybe later, depends. ; https://www.dropbox.com/sh/nqpbbs823e1m52p/AACuYBnKAW_c-igrJFXZzgzea?dl=0 ; On request I revalidated the double entries of the 2015 posts so the links all work again. ; Albrecht ; ------------------------------Start Par---------------------------------- 30007-12 { ; Into Chaos ; Bees-Newton ; Time 0.28.02.80 Reso 1280/1024 ; Outside Border Backwards -Now Inside reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=ident/ident/cos/exp passes=t center-mag=-0.021232/5.44009e-015/2.256171/1/90/3.88578058618804789e-016 params=4.123456789123456/0.1/37000.32595701001/54004.0506031804/432048.0\ 404808/33.16048940221/14.3432700812/256.100002595/512.1007683001/64.2000\ 000004998 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000607<2>406306305305<3>114113013<9>041051050<4>270270280<3>4905A\ 05A0<23>MO4NO4OP5<5>RS7RT7ST8<3>TWATWAUXA<8>U`FUaFUaG<3>TcIScJScJ<5>PfMO\ fNOfO<5>KhRJhRIhSHhSHiTGiT<7>AiX9iY9jY<8>3ia3ia2ib<3>1hc1hc0hd<9>0ef0df0\ df<7>3ag3`g4`g5_g<8>AWfBVfCVfDUfDUf<9>LOcLNcMNcNMbNMbOLb<4>RI`RI_SH_<3>T\ FYTEYUEX<8>U9TU9SU8S<4>S6PS6PS5O<3>Q4MP4LP3L<4>L2IL2IK1H<11>B0BA0AA0A90A\ <3>608 } -------------------------End-----------------------------------------------

1 0

FOTD 09-02-15 (The Reluctant Fairy [A-6,M-7])
by Jim Muth 09 Feb '15

09 Feb '15

FOTD -- February 09, 2015 (Rating A-6,M-7) Fractal visionaries and enthusiasts: Perhaps we should rename the FOTD the FOTM -- "Fractal of the Month". It's been a couple weeks since the last image appeared. But despite appearances I am still searching for fractals in between doing other things such as drawing by hand the other-worldly surreal landscapes I often try to capture in fractal images. Today's image is an odd-plane scene in Seahorse Valley of the Mandelbrot set. I chose it as today's FOTD because of the prominent spiral that changes direction as it crosses the valley. As is usually the case in these odd-plane images, some stretching and skewing was needed to bring the scene to recognizable proportions. The rather poetic name, "The Reluctant Fairy", has nothing to do with the image. It simply came to mind when I shut off my rational thinking, something FL claims I often do. The art rates a nominal 6 because of the not very exceptional coloring; the math rates a 7 because of the curious two-way spiral. The calculation time of 4-1/2 minutes might be a little more than the image is worth. The image may be viewed by running the parameter file or by checking the web sites at: <http://www.crosscanpuzzles.com/Archives.html> <http://www.emarketingiseasy.com/TESTS/FOTD/jim_muths_fotd.html> <http://www.Nahee.com/FOTD/> <http://user.xmission.com/~legalize/fractals/fotd/about.html> where it might be posted. The official web site is currently down. Miserable winter weather prevailed here at Fractal Central today, with a steady light rain, a temperature of 32F 0C and spotty icy spots making both walking and driving treacherous. The fractal cats, who neither walk outdoors nor drive anywhere, were unconcerned. The fractal humans passed the day indoors, avoiding the outside weather. I haven't the foggiest idea when the next FOTD (FOTM) might appear, but I have a good feeling it will eventually show up. Until whenever, take care, and spiritual bankruptcy goes far deeper than simply not believing in God. Jim Muth jimmuth(a)earthlink.net START PARAMETER FILE======================================= TheReluctantFairy { ; time=0:04:30.00 SF5 at 2000MHZ reset=2004 type=formula formulafile=basicer.frm formulaname=SliceJulibrotSqr passes=1 center-mag=0/0.521639/12.12754/0.4453/90/68.6631407 params=10/90/0/90/-0.7492/0/0/0/0/0 float=y maxiter=4800 inside=0 logmap=32 periodicity=6 colors=0003ia7eaB`aFXaJVgNUdRTaVSZZRWbQTfPQjONnNKr\ LHrMIoMImMJjMJhMJeMKcMK`MKZMLWMLUMLWNPYOT_PXaQ`bRd\ dShfTlhUpiUtjVqkWolXlmYjmYhnZeo_cp``p`ZqaXrZUsWStT\ asQWsSQvUDtWHsYKrXNqWQpUToTWnS_mQblQekQhjPknOmkMni\ LngJneIncHnaFn_EnYDnWBnUAnS9nQ7nO6nM5nN7mO9mPBlQDl\ REkSGkTIjUKjVMiXLkWMjWNiWOhVPgVQgVRfUSeUTdUUcS_fUU\ cWOaXJ_ZDX`7V`5Ua2Tb5Pc7MdAJeCGfFCgH9hK6iM3iO0ZP4P\ Q8FRC4ND5PF5RG5TI5VJ6XL6ZM6`O6bP7dR7fS7hU4pP6lS7iV\ 8eX9b_A_aBWdCTfEQiFMlGJnHGqICsJ9vK6xRFsXKoWKjVKeUK\ fUKfUKfTIgUGgQEhMDgMFgOGgPIgRJgSLgUNgVOgXQgYRg_Tga\ PqaSl`UgWXbQZYKaTFcO9fJ4hFEgGOgHXgIffJdfKafK_gLYhL\ XiMWjMPkNIkNJiRKhULgYMf`NecOdgPcjQbmRaqS`tU`vS_wQZ\ wOYwMYwKXwIWwGWxEVxCUxAUx8Tx6Sx5Sx7Qv9OuBNsCLrEKpG\ IoHHmJFlLDkMCiOAhQ9fR7eT6cV4b71kK2fW3am4Wj3Xg3Yd2Z\ a2_Z2`SBY5LMMJWaHdpBoqFmqIkrLirOgsResUdsYbt``tcZug\ XskVsocssmwwzwwzwwzzwzzwz } frm:SliceJulibrotSqr {; draws all slices of Julibrot pix=pixel, u=real(pix), v=imag(pix), a=pi*real(p1*0.0055555555555556), b=pi*imag(p1*0.0055555555555556), g=pi*real(p2*0.0055555555555556), d=pi*imag(p2*0.0055555555555556), ca=cos(a), cb=cos(b), sb=sin(b), cg=cos(g), sg=sin(g), cd=cos(d), sd=sin(d), p=u*cg*cd-v*(ca*sb*sg*cd+ca*cb*sd), q=u*cg*sd+v*(ca*cb*cd-ca*sb*sg*sd), r=u*sg+v*ca*sb*cg, s=v*sin(a), esc=imag(p5)+9 c=p+flip(q)+p3, z=r+flip(s)+p4: z=z*z+c |z|< esc } END PARAMETER FILE=========================================

1 0

Dimensional Gate
by JackOfTradeZ＠comcast.net 09 Feb '15

09 Feb '15

. You are cruising thru the inky darkness of interstellar space, when you suddenly encounter ... the ... Dimensional Gate ! http://www.fractal-animation.net/vid/dim_gate.zip 87 sec, 640WMV, 25MEG .

3 2

Bees-Secant Zooms
by Niekamp 08 Feb '15

08 Feb '15

Spent two days testing and configuring WinXP X64 on VMware and must admit I´m impressed. Speed and feel are almost like the real edition which used to be my favorite for a long time. The main drawback is the missing access to nvidia graphics and the bad lan communication with the host win7, but it has full access to my XP computer. ; Maybe you have been waiting for the zooms into the Bees-Secant parent, but like I said there is an infinite number so it´s just a small selection. ; https://www.dropbox.com/sh/41mqb2zgdt40xk2/AAD6hZSqEFWCLjKp4KoulaYWa?dl=0 ; Hal has found out for me that there may be some loss of coloring quality using the parfiles due to larger steps beween the colors - more and specific info hopefully later. Any loss of quality can be avoided by clicking on the three dots in the lower right corner of the dropbox image and picking the "original". ; Albrecht ; --------------------------Start Par---------------------------------------- 30001-23 { ; Hermaphrodite ; Bees-Secant ; Time 0.06.18.87 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/exp passes=t center-mag=+0.19084994759683450/-0.08758731763020938/4126.423/1/-37.5000\ 000000028777/2.79927470092644626e-012 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000IpA<2>GoFGnHFmK<7>Aha9gc9gf<3>7dn6cp6bq<3>4_w4Zx3Yy<3>2Vz2Vz1U\ z<3>1Rx0Qw0Pv<3>0Mo0Ln0Ll<6>0GX0FV0ES<3>1CJ1001AF<3>288386375<3>55155064\ 0<3>830830921<3>B15C17C18<3>F0FF0HG0K<7>M0aN0cN0f<3>Q0nR1pS1q<3>V2wW2xX3\ y<3>_4z`4z`5z<3>c7xd7we8v<3>hAoiAniBl<5>mFZnGXoGV<3>qJMqKJrLH<3>tO9tO8uP\ 6<3>wS2wT1wU0<3>xX0yY0yY0<3>za4za5zb7<3>zeDzfFzgH<8>zmaymcynf<3>xpnxqpxr\ q<3>vtwvtxuuy<3>tvzswzswz<3>qxxpxwoyv<3>mzolznlzl<10>dzOczMbzJ<3>_yBZy9Z\ y8<3>Vx3Vx2Uw1<3>Rv0Qu0Pu0<4>Ls4Lr5Kr7Jq8 } 30001-27 { ; Strict Hierarchy ; Bees-Secant ; Time 0.09.16.01 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/exp passes=t center-mag=+0.19072095522042810/-0.08775171972972690/644753.6/1/-139.499\ 999999357016/-6.882843670008576e-010 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000ElO<5>Aha9gc9gf<3>7dn6cp6bq<3>4_w4Zx3Yy<3>2Vz2Vz1Uz<3>1Rx0Qw0P\ v<3>0Mo0Ln0Ll<6>0GX0FV0ES<3>1CJ1001AF<3>288386375<3>551550640<3>83083092\ 1<3>B15C17C18<3>F0FF0HG0K<7>M0aN0cN0f<3>Q0nR1pS1q<3>V2wW2xX3y<3>_4z`4z`5\ z<3>c7xd7we8v<3>hAoiAniBl<5>mFZnGXoGV<3>qJMqKJrLH<3>tO9tO8uP6<3>wS2wT1wU\ 0<3>xX0yY0yY0<3>za4za5zb7<3>zeDzfFzgH<8>zmaymcynf<3>xpnxqpxrq<3>vtwvtxuu\ y<3>tvzswzswz<3>qxxpxwoyv<3>mzolznlzl<10>dzOczMbzJ<3>_yBZy9Zy8<3>Vx3Vx2U\ w1<3>Rv0Qu0Pu0<3>Ms3Ls4Lr5<3>IpBHoDGoFGnHFmKEmM } 30001-29 { ; Trampoline ; Bees-Secant ; Time 0.03.08.61 Reso 1280/1024 reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/exp passes=t center-mag=-0.429274/0.000510143/13.82034/1/90/-1.23373533611470521e-014 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000000000304708000D0F<5>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1\ R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdV\ faS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7\ >gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A0800\ 4000<29>000 } 30001-35 { ; Far Away ; Time 0.00.40.04 Reso 1280/1024 ; Zoom with increased compression ; Found outside of the parent image reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/ident passes=t center-mag=-0.57399410210741870/-2.22283663860311600/59.43108/1/24.00000\ 00000014317/-8.647249583049188e-013 params=4.123456789123456/0.1/30001.32595700007/20004.0506031804/152048.0\ 404808001/11.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3000220195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000304708000D0F<5>X0a_0dc0h<3>p\ 0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5\ <16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } 30001-43 { ; Deep Zoom ; Time 0.01.48.42 Reso 1280/1024 ; Zoom with increased compression ; reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/ident passes=t center-mag=-0.55408700482952280/-2.21715898257025000/2.007181e+007/1/81.\ 9999999624756271/3.35740246576454737e-008 params=4.123456789123456/0.1/30001.32595700007/20004.0506031804/152048.0\ 404808001/1.16048940221/384.3132705812239/256.100002595/512.1007683001/2\ 048.3000010195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000<12>000000000<3>000330<6>220220220<3>110000110<2>000KA4<7>gcOj\ gRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<\ 26>000<4>000304708000D0F<5>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>\ 7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<\ 3>VMCRI8OE4KA0000<29>000 } ------------------------------------End------------------------------------

1 0

Petal Webs
by Mike Frazier 08 Feb '15

08 Feb '15

This fractal is one I found while exploring variations of the parallel resistor formula with 3 terms. The formula in this case mixes cosh, sinh, and z: z=1/(1/((cosh(z)-1)+pixel+1) + 1/(z*sinh(z)+pixel-1) + 1/(z*z+pixel)) The equation was constructed so that the minimum power of z representing the series for each term is 2. Thats the reason for the -1 after the cosh and the extra z* in front of the sinh. I haven't made any conclusions about whether or not 3 terms is better than 2 terms but it certainly is different. Here is a link to an image: http://dl.dropboxusercontent.com/u/33642054/image/petal_webs_1200_5.jpg I liked how the inside stuff in the image was filled with the "webs". Even the arms of the webs have little webs along the sides. The FractInt compatible PAR file for the image is: petal_webs { ; Exported from Fracton. reset=2004 type=formula formulafile=fracton.frm formulaname=F_20150208_1101 passes=1 float=y center-mag=-6.997039369982983/0/2222.22225/1/0/0 params=0/0/0/0/-1/0/1/0/0/0 maxiter=10000 inside=0 logmap=10 periodicity=6 colors=000APIAPIAPIAPIAPIARLARLARLARLBTOBTOBTOBTOB\ TOBVRBVRBVRBVRBXUBXUBXUBXUBXUBZXBZXBZXBZXB`_B`_B`_\ B`_CabCabCabCabCabCceCceCceCceCehCehCehCehCehCgkCg\ kCgkCgkCinCinCinCinCinCkqCkqCkqCkqDlsDlsDlsDlsAKAA\ KAAKAAKAAKAAKAAKAAKADMDDMDDMDDMDDMDDMDDMDDMDFPGFPG\ FPGFPGFPGFPGFPGFPGIRJIRJIRJIRJIRJIRJIRJIRJLTMLTMLT\ MLTMLTMLTMLTMLTMNWPNWPNWPNWPNWPNWPNWPNWPQYSQYSQYSQ\ YSQYSQYSQYSQYST`VT`VT`VT`VT`VT`VT`VT`VWbYWbYWbYWbY\ WbYWbYWbYWbYYe`Ye`Ye`Ye`Ye`Ye`Ye`Ye``gc`gc`gc`gc`g\ c`gc`gc`gccjfcjfcjfcjfcjfcjfcjfcjfelielielielielie\ lielieliholholholholholholholholkqokqokqokqokqokqo\ kqokqomsqmsqmsqmsqmsqmsqmsqmsqkqokqokqokqokqokqokq\ okqoholholholholholholholholelielielielielielielie\ licjfcjfcjfcjfcjfcjfcjfcjf`gc`gc`gc`gc`gc`gc`gc`gc\ Ye`Ye`Ye`Ye`Ye`Ye`Ye`Ye`WbYWbYWbYWbYWbYWbYWbYWbYT`\ VT`VT`VT`VT`VT`VT`VT`V000 } frm:F_20150208_1101 { ; Similar to the parallel resistance formula z=0,c1=pixel-p3,c2=pixel-p4: z=1/(1/((cosh(z)-1)+c1)+1/(z*sinh(z)+c2)+1/(z*z+pixel)), |z|<100 } -- Mike Frazier www.fracton.org

1 0

<David> Re: If the Fractint window isn't active when I use Ctrl-1...
by Hal Lane 07 Feb '15

07 Feb '15

> If the Fractint window isn't active when I use Ctrl-1, > everything is fine. This potential workaround might or might not help: Running DOS Fractint under WinXP and using <alt><Enter> to switch between: - full screen Fractint and - Fractint in a window, I sometimes lost my Windows cursor. I found that if I always had Fractint showing a text window -- instead of an image, that I would never lose my cursor. Maybe trying this could help with the problem you describe. My usage of Fractint is such that I typically find a zoom into a fractal I want to calculate at a resolution that requires a Disk Video Mode -- so after I start that I have a text screen -- and I can switch Fractint from full screen to a window knowing that I'm not risking losing my cursor. I guess you could use (or define in Fractint.cfg) Disk Video Modes for normal viewable resolutions and switch away while still doing 'investigations' at a low resolution. When you came back to Fractint you would save the completed image and (R)estore it in a viewable video mode... It's called a WORKaround for a reason, I guess... - Hal Lane (\__/) ######################## (='.'=) # hallane(a)earthlink.net (")_(") ######################## =========================================== Author: david Date: 2015-02-04 04:31 -500 To: Fractint and General Fractals Discussion Subject: Re: [Fractint] Which OS does Fractint like best? Just downloaded it again and tried it again. Here's what happens: For a few seconds, I see a menu, I think of 3 or 4 items? Doesn't stay up long enough for me to read or pick anything from it. Then it goes to the bad or missing command interpreter message, and the VM hangs. Tried again. By hitting a cursor key, I got to select menu item 1 (the JEMEX one?). That gives me the bad or missing command interpreter message. Picking option #2 got me to a DOS prompt. CDed to fractint and started Fractint. Let it render a mandelambda at 1280x1024x256 and zoomed in. Then, while it was rendering, I switched away using Ctrl-1 (to switch to my primary XFCE desktop, I was running it on my 3rd desktop) and the Fractint window turned into a blank "text size" window that didn't respond to keyboard or mouse input. Had to kill it from the VM manager. (The 1280x1024 mode is the Chips & Tech one, maybe it doesn't get along with the virtual video card.) If the Fractint window isn't active when I use Ctrl-1, everything is fine. So I guess it goes back to the keymapper ... So: menu option 1 doesn't work at all for me. #2 and 3 work. #4 works but attempting to zoom using the mouse gets not response, it doesn't include the mouse driver. After it got working, I tweaked the appliance settings. I loathe and don't use PulseAudio, so I switched the audio to use ALSA. I may disable audio support since I don't use it in Fractint, anyway. Is there a reason why you give the VM 32MB of memory? That seems to be way beyond what any version of DOS ever supported. Suggestion re the menu: can you make it stop there so the user has to pick something? Or stop there longer? It seems to only wait a second or two on this 2.4GHz i7 laptop here. My old DOS days are long ago or I'd poke around in AUTOEXEC.BAT, where I guess it's happening? I have LinuxMint17 Cinnamon running on a VM here, but I'm also using the XFCE desktop there, not Cinnamon. Thanks for the appliance, now just need to figure out how to get a 1920x1080x256 display mode that isn't distorted. ======================================= --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

Jonathan - MFR_13
by Albrecht Niekamp 06 Feb '15

06 Feb '15

Jonathan, if you are reading my posts you know that I have difficulties because more then 4 FN variables are needed to complete my task of generating a new work of art from the basic image. Do you think it will be possible to add fn5 to fn8 to fractint ?? You said you are working on an update with increased buffer size. I know this is a new country again but it´s not the first time and that could be a suitable tool to combine fractal mathematics and art using my Warp Effect. Thank you so much for any help!! Petta

3 2

Parent View
by Niekamp 05 Feb '15

05 Feb '15

The combination of Bees and Secant offers an infinite number of zooms, some obscure, some beautiful and some of a special nature that occurs when the bilateral data are perfectly mixed. Today´s presentation is the parent image that looks best on a big flatscreen for panorama viewing. Yesterday´s link remains: https://www.dropbox.com/sh/41mqb2zgdt40xk2/AAD6hZSqEFWCLjKp4KoulaYWa?dl=0 ; Albrecht ; --------------------------------------Start Par--------------------------- 30001-24 { ; Parent View ; Bees-Secant ; Time 0.03.47.06 Reso 1280/1024 ; The perfect zooming playground reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/exp passes=t center-mag=0.727874/0.00775151/0.691017/1/90/3.88578058618804789e-016 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000708000D0F<5>X0a_0dc0h<3>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`\ Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMC\ RI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<7>gcOjgRmj\ T<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>0\ 00<4>000304 } ------------------------------------Ebd------------------------------------

1 0

multifractalz
by JackOfTradeZ＠comcast.net 05 Feb '15

05 Feb '15

. Thanx - the new FRM worx. Interesting complex images; I do not see bees or insects, but they do have a "biologic" look, like from an "alien" movie. .

1 0

multifractalz
by JackOfTradeZ＠comcast.net 05 Feb '15

05 Feb '15

. Was anyone able to render [ FSOL, Magnetic Bees Zoom1,2,3 ] ?? I just get a blank (colored) picture. There is a code error but I can't find it; appears to be in the "parameters" line. WTF .

2 1

Re: [Fractint] I'd like to virtualize & host my entire WinXP computer on Win8.1 - Help.
by Hal Lane 05 Feb '15

05 Feb '15

Thanks for all the suggestions, everyone. I'm using them to look for more links and experiences of people who've tried these out and written them up. - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

FSOL
by Niekamp 04 Feb '15

04 Feb '15

Watching the traffic in this forum you cannot avoid noticing that it comes alive only if the subject is hardware. With the exception of Hal and Jack there is NOT ANY one posting with reference to fractals. Why? What is the use of sophisticated hardware without progressive and matching contents? But probably I will not get an answer again. ; Continuing with new mates for the Bees - Secant today. There are images with both but in connection with ManyMods, - wait for Jack´s animation -, where Manymods plays the main part. The two alone are a world of it´s own. Remember The Future Sound of London? This is the guitar they are playing. , Albrecht ; https://www.dropbox.com/sh/41mqb2zgdt40xk2/AAD6hZSqEFWCLjKp4KoulaYWa?dl=0 ; -----------------------------------------Start Par----------------------- 30001-10 { ; FSOL ; Bees-Secant ; Time 0.10.43.17 Reso 1280/1024 ; SG Miracle Map reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/sin/exp passes=t center-mag=0.270922/-0.000189856/24.42792/1/90/3.88578058618804789e-016 params=4.123456789123456/0.1/30001.32595700002/20004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 2048.3002200195 float=y maxiter=3072 inside=maxiter periodicity=0 rseed=-2436 colors=000507406<6>114113013<9>041051050<4>270270200380<7>7C08C09D09E0<1\ 7>MO4NO4OP5<5>RS7RT7ST8<3>TWATWAUXA<8>U`FUaFUaG<3>TcIScJScJ<5>PfMOfNOfO<\ 5>KhRJhRIhSHhSHiTGiT<7>AiX9iY9jY<8>3ia3ia2ib<3>1hc1hc0hd<9>0ef0df0df<7>3\ ag3`g4`g5_g<8>AWfBVfCVfDUfDUf<9>LOcLNcMNcNMbNMbOLb<4>RI`RI_SH_<3>TFYTEYU\ EX<8>U9TU9SU8S<4>S6PS6PS5O<3>Q4MP4LP3L<4>L2IL2IK1H<11>B0BA0AA0A90A<5>507 } -----------------------------------------------------End------------------

3 2

I'd like to virtualize & host my entire WinXP computer on Win8.1 - Help.
by Hal Lane 04 Feb '15

04 Feb '15

Does anyone know anything about virtualizing an entire WinXP machine and hosting it under Win8.1? I just got a powerhouse of a new computer, and I'm looking for a *temporary* way to keep all the apps and drivers I will lose when I fully commit to the Win 8.1 machine. Over time I will be replacing WinXP apps that will not run under Win 8.1 -- but I need to get the new machine working efficiently pretty quickly, and I don't want to suddenly lose all the capability I've built up over many years in my Win XP computer. I believe that the new computer's 16 GB RAM, 4 GHz eight hyper-threaded cores & 2 TB drive (+ SSD helper drive) will actually support this (obscure reference follows) checkers-playing-dog, even if it wins very few games. I got the idea of virtualizing my WinXP computer here: http://tinyurl.com/Virtualize-Windows-XP-computer or: http://www.infopackets.com/news/9473/how-copy-programs-windows-xp-windows-8 I was encouraged when I found this: "Intel and AMD have ... developed virtualization extensions to the x86 architecture. ... Either will allow a virtual machine ... to run an unmodified guest operating system *without* *incurring* *significant* emulation *performance* *penalties*." I would not use the WinXP browsers or email to help mitigate its security risks. Any recommendations, experiences, gotchas, links, etc. about virtualizing and hosting an entire WinXP machine would be greatly appreciated. Thanks, - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

5 6

Which OS does Fractint like best?
by Knute Myhrvold 04 Feb '15

04 Feb '15

I haven't been able to use Fractint since back when I had Win98 & NT; it won't run on my WinXP-MediaEd now (Intel machine), though I understand XP may work with Fractint on an AMD machine. My question is this: Which OS does Fractint "like" the best... Which OS will it run the best on??? [Unless Fractint runs much, much better on DOS (MS-DOS, FreeDOS, etc.), I would really prefer an OS with a GUI... for my sake.] So, what do you think?: Win98; Win98SE; ME; NT3-4; 2000(NT5.0); WinXP-Media-Pro-SP3; 7... ? 32-bit? I've just ordered an old AMD PC just for Fractint (Dell OptiPlex 740 Athlon 64 X2 4600+ 2.4GHz 1GB 80GB CDRW/DVD XP Professional Desktop) ... I don't know the Video card yet. There's a chance Fractint may work on this AMD with WinXP Pro, but what do you think would be the best OS for Fractint on this machine? Thanks much for your suggestions!! ...Knute --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

7 9

Magnetic Bees Zooms
by Niekamp 03 Feb '15

03 Feb '15

Here are 3 zooms into the Magnetic Bees image, settings identical. There are many more and they are fast! All use the Albrecht.map that is my trademark since 2003 when I programmed the Fractint Splash Screen. On some images it´s still the best. ; https://www.dropbox.com/sh/i0t3eom2l5fjhko/AAA75HTAc0d2LppiGkaJFXbEa?dl=0 ; Since I assume that the double links are not needed any more they are now deleted, so all posts must be selected from the 2015 link. Here it is once more: https://www.dropbox.com/sh/sbcd32dj2z1ynp1/AABe20vULYUZGCnGUwHYjxZga?dl=0 and also the link to the archives: https://www.dropbox.com/sh/rzymsbt18j4fw13/AABG0h4mImmkSKmc0Chqitxla?dl=0 ; save them on a safe place. ; Albrecht (as Hal still uses my real name I´m giving in) ; ----------------------------Start Par------------------------------------- 30008-13 { ; Magnetic Bees Zoom1 ; Time 0.02.28.19 Reso 1280/1024 ; Albrecht.map reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=+1.92992594033264500/+0.00015403030893974/137.7201/1/90/3.885\ 78058618804789e-016 params=4.123456789123456/0.1/30008.32595700005/10004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 512.2002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000110<2>000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3\ >z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_\ 0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kk\ ammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<\ 4>000 } 30008-06 { ; Magnetic Bees Zoom2 ; Time 0.05.45.15 Reso 1280/1024 ; Albrecht.map reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=+1.91701017764372100/-0.00121097263807415/33.60371/1/90/3.885\ 78058618804789e-016 params=4.123456789123456/0.1/30008.32595700005/10004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 512.2002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } 30008-14 { ; Magnetic Bees Zoom3 ; Time 0.04.01.01 Reso 1280/1024 ; Albrecht.map reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=+1.92719152210571100/-0.00009415204506278/247.0861/1/90/-1.23\ 373533611470521e-014 params=4.123456789123456/0.1/30008.32595700005/10004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 512.2002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000wv`zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0F<3>z0K<6>Z0EV0DR0C<3>A0800\ 4000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<4>_0dX0aU0Y<2>K0NH0JG0NE1R<\ 3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16>kkammcpoe<3>zwm<3>mhZjdVfa\ S<3>VMCRI8OE4KA0000<43>000<4>000330<6>220220220<3>110000110<2>000KA4<11>\ trZ }

1 0

Re: [Fractint] Magnetic Bees
by Hal Lane 03 Feb '15

03 Feb '15

> Thanks, Hal. > Both links show Error 404 - not found - they refer to Dropbox? > Albrecht They do refer to your image in DropBox. I got the link I posted (that fails) by - going to your DropBox link https://www.dropbox.com/sh/g77fdjs5eymc43r/AADJoazPBeUfpnE02PiuBV1Ba?dl=0 - clicking on the thumbnail image, - right clicking the larger image that appears, and - choosing "View original..." Their 'original' image appears in a new tab in my Chrome browser, and I just copied and pasted that link. Apparently, Dropbox doesn't like that "deep linking" so you'll have to navigate to it as I described above -- or view a copy of the fractal I put on my server: http://www.emarketingiseasy.com/Albrecht/Misc/30008-05.GIF I'm starting the anti-aliased version right now... - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Magnetic Bees
by Hal Lane 03 Feb '15

03 Feb '15

Albrecht, Your Feb. 1, 2015 fractal, "Magnetic Bees", 30008-05.GIF is really great! http://tinyurl.com/Magnetic-Bees or: https://dl.dropboxusercontent.com/content_link/icoJDdnXlUFuLNMRxZvhcEg3RB2Q5 GYKV5xHoW3p7sJ5JZkz73clAjVmZhC2zNTq Would someone please 3D print it? I think I will anti-alias this one and post it! - Hal Lane ######################## # hallane(a)earthlink.net ######################## --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

Re: [Fractint] I am STILL learning things about [Fractint!]
by Hal Lane 03 Feb '15

03 Feb '15

> I am STILL learning things about [Fractint]! Like hitting > the "L" key while color cycling to see and choose > MAP files from the directory. One of the Fractint features that I didn't discover for quite a while was that in the "E" color palette/map editor, it can not only "L"oad different color map .MAP files, but it also has 8 temporary map locations. You can load, rotate, create new random maps, etc. and temporarily hold onto each of them -- and switch between using any of these temporary maps with a "touch of a key" specifically: F2 - F9. The "Save to Temporary Color Palette" keys are: <shift>F2 - F9. Whatever color palette is being used when you exit the "E" color editor will be the one saved with the image, when you save it. Note that the contents of all the temporary color maps are lost when you exit the color editor, so if you have created a palette/map you don't want to lose, switch to using it, and "S"ave it to a .MAP file while you're still in the color editor. You have to add the ".MAP" to the file name -- Fractint doesn't supply it. Note that F2 - F9 have a different use in the "C" Color Cycling Commands mode. Another of my favorite discoveries in the "E" color palette/map editor is the "X" key: "<X> - Toggle 'exclude' mode on or off - when toggled on, only those image pixels which match the active color are displayed." I find it useful to see all the locations in a fractal that a particular color is used. You can select the color by moving the cursor over the grid of color "chips" or the image itself. Repeatedly hit "X" to bring back the full complement of color chips -- that temporarily disappear in exclude mode. If your Fractint Color Editor cursor is not able to be moved with your mouse, remember that the <ctrl> key accelerates the movement of the arrow keys... There are numerous additional goodies in the "E" color/palette editor -- many of which I still don't know how to use... Ethan Nagel created the palette editor. Ref: FracDoc 20.4 Page 26 "Palette Editing Commands" - Hal Lane ######################## # hallane(a)earthlink.net ######################## ============================================ Author: JackOfTradeZ Date: 2015-02-02 17:01 -500 To: fractint Subject: [Fractint] How 2 run FractInt Knute, If you are in DOS just type "fractint" and hit ENTER. If you have the MAP, CFG and sstools.ini present it should just come up and run. You can also type "fractint makedoc" and it will create a large and detailed instruction file; it has a "doc" extension but it is a plain ascii text file - read it from DOS or windows notepad. I have been using fractint for over 15 years and i am STILL learning things about it! Like hitting the "L" key while color cycling to see and choose MAP files from the directory. Have fun. ============================================= --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

1 0

Re: [Fractint] Which OS does Fractint like best?
by Knute Myhrvold 03 Feb '15

03 Feb '15

I finally got Oracle's VirtualBox running; also got FreeDOS 1.1 installed in VirtualBox; also installed the "per-configured virtual machine on the www.fractint.org site. (FreeDOS with Fractint pre built)" into the VirtualBox. Still can't find Fractint anywhere in the VirtualBox; the FreeDOS 1.1 Guest just comes up with a plain DOS window that I can't get to do anything. The FreeDOS-with-Fractint Guest is exactly the same. So I created a Folder with Fractint in it: "C:\DOS\fractint" (with fractint.exe in \fractint). I then configured both Guests to have C:\DOS\fractint as "Shared Folders". Result: no Fractint, no nothin'. The DOS window ends with C:\>_ awaiting my command I guess, but whatever I type in results in "Bad command or filename -". I've typed in "DOS\fractint"; "C:\DOS\fractint" and "C:\DOS\fractint\fractint.exe" (all followed with "Enter")... all "Bad commands". I've tried to learn how to install Fractint into FreeDOS in Virtualbox but see no way of doing it. So I simply double clicked fractint.exe in its Shared Folder and it wouldn't open, as usual. So, now that I have DOS how do I run Fractint??? &/or What is the Command I enter into DOS??? To Paul N. Lee RE your letter of 1/30: Thx very much for your overview & suggestions! I'll follow thru with them when I get my old PC. To Nick Grasso RE your letter of 2/1: Thx much for your input. I may eventually bite the bullet and download MS-DOS or try DOSBox in order to finally run Fractint. Your question "If you are just running Fractint, why do you need a GUI?" is reasonable:) Altho' I used Fractint in the 90s I never really learned DOS & I don't want to have to learn it now; I just thought it'd be easier for me with a GUI. & more, but must end for now. ~Knute --- This email has been checked for viruses by Avast antivirus software. http://www.avast.com

2 1

Dimensional Gate
by JackOfTradeZ＠comcast.net 02 Feb '15

02 Feb '15

. The ZooM-in animation of the "Dimensional Gate" fractal is in progress. The detail and complexity of this fractal is amazing. I am rendering it at 1400 so gonna take awhile .... stay tuned. JoTz .

2 1

How 2 run FractInt
by JackOfTradeZ＠comcast.net 02 Feb '15

02 Feb '15

Knute, If you are in DOS just type "fractint" and hit ENTER. If you have the MAP, CFG and sstools.ini present it should just come up and run. You can also type "fractint makedoc" and it will create a large and detailed instruction file; it has a "doc" extension but it is a plain ascii text file - read it from DOS or windows notepad. I have been using fractint for over 15 years and i am STILL learning things about it! Like hitting the "L" key while color cycling to see and choose MAP files from the directory. Have fun. .

1 0

Magnetic Bees
by Niekamp 02 Feb '15

02 Feb '15

Bees and Magnet is a new combination and it fits! Both parts modified, but only slightly. ; https://www.dropbox.com/sh/g77fdjs5eymc43r/AADJoazPBeUfpnE02PiuBV1Ba?dl=0 ; This is the link again for the 2015 folder that contains all posts of this year. Please save it where you always can find it. https://www.dropbox.com/sh/sbcd32dj2z1ynp1/AABe20vULYUZGCnGUwHYjxZga?dl=0 ; Petta ; -----------------------------------Start Par----------------------------- 30008-05 { ; Magnetic Bees ; Time 0.01.35.01 Reso 1280/1024 ; Bees-Magnet first time ever ; Albrecht Map reset=2004 type=formula formulafile=mfr_13.frm formulaname=multifractal_13 function=acos/ident/cos/exp passes=t center-mag=2.02288/-0.00121097/4.099653/1/90/3.88578058618804789e-016 params=4.123456789123456/0.1/30008.32595700005/10004.0506031804/152048.0\ 404808001/33.16048940221/384.3132705812239/256.100002595/512.1007683001/\ 512.2002280194999 float=y maxiter=2048 inside=maxiter periodicity=0 rseed=-2436 colors=000<2>110110000KA4<7>gcOjgRmjT<3>zzc<9>UOFRKDOGA<3>A00<9>f0Ci0Dl0\ F<3>z0K<6>Z0EV0DR0C<3>A08004000<26>000<4>000<7>Q0UU0YX0a_0dc0hf0l<2>p0w<\ 4>_0dX0aU0Y<2>K0NH0JG0NE1R<3>7UX6`Z4h_2oa0wc<10>2WI2TG2RE<3>4G54D36F5<16\ >kkammcpoe<3>zwm<3>mhZjdVfaS<3>VMCRI8OE4KA0000<43>000<4>000330<12>110 } ------------------------------------------------End-------------------------

1 0